fdhA - STRING protein network

There are several matches for 'fdhA'.
Please select one from the list below and press Continue to proceed.

organism

protein

Escherichia coli K12 MG1655

selB - Selenocysteine-specific elongation factor; Translation factor necessary for the incorporation of selenocysteine into proteins. It probably replaces EF-Tu for the insertion of selenocysteine directed by the UGA codon. SelB binds GTP and GDP; Belongs to the TRAFAC class translation factor GTPase superfamily. Classic translation factor GTPase family. SelB subfamily [a.k.a. b3590, JW3563, fdhA]

Escherichia coli K12 MG1655

selA - L-seryl-tRNA(Sec) selenium transferase; Converts seryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis. Requires selenophosphate as the selenium-donor molecule; Belongs to the SelA family [a.k.a. b3591, fdhA, JW3564]

Acidobacterium capsulatum

fdhA - Formate dehydrogenase, alpha subunit; Identified by match to protein family HMM PF00037; match to protein family HMM PF00111; match to protein family HMM PF00384; match to protein family HMM PF01568; match to protein family HMM PF04879; match to protein family HMM TIGR01591

Acinetobacter calcoaceticus

fdhA - annotation not available

Actinoplanes sp. N902109

fdhA - annotation not available

Actinoplanes sp. SE50110

fdhA - Glutathione-independent formaldehyde dehydrogenase; Threonine dehydrogenase and related Zn-dependent dehydrogenases

Aeromonas hydrophila ATCC7966

fdhA - Formate dehydrogenase, alpha subunit, selenocysteine-containing; Selenoprotein. identified by match to protein family HMM PF00384; match to protein family HMM PF01568; match to protein family HMM PF04879; match to protein family HMM TIGR01591; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Agrobacterium fabrum

fdhA - annotation not available

Agrobacterium radiobacter

fdhA - annotation not available

Agrobacterium sp. H133

fdhA - Formaldehyde dehydrogenase, glutathione-independent, Alcohol dehydrogenase GroES-like domain; Threonine dehydrogenase and related Zn- dependent dehydrogenases

Agrobacterium tumefaciens CCNWGS0286

fdhA - Glutathione-independent formaldehyde dehydrogenase; COG1063 Threonine dehydrogenase and related Zn-dependent dehydrogenases

Agrobacterium vitis

fdhA - annotation not available

Aliivibrio salmonicida

fdhA - annotation not available

Amycolatopsis japonica

fdhA - Formate dehydrogenase subunit alpha; Catalyzes the oxidation of formate; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Anaerococcus vaginalis

fdhA - 2Fe-2S iron-sulfur cluster binding domain protein; COG: COG3383; Pfam: PF00111,PF00037; InterPro: IPR001041

Arthrobacter globiformis

fdhA - annotation not available

Azotobacter vinelandii

fdhA - annotation not available

Babela massiliensis

fdhA - annotation not available

Bacillus megaterium QM B1551

fdhA - annotation not available

Bacillus methanolicus MGA3

fdhA - annotation not available

Bacillus methanolicus PB1

fdhA - Formate dehydrogenase alpha chain; COG0243 Anaerobic dehydrogenases, typically selenocysteine-containing; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Bacillus pseudofirmus

fdhA - Putative formate dehydrogenase catalytic subunit; COG0243 Anaerobic dehydrogenases, typically selenocysteine-containing; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Bacillus simplex

fdhA - annotation not available

Blastococcus saxobsidens

fdhA - Formaldehyde dehydrogenase; Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type e : enzyme

Bordetella bronchiseptica

fdhA - Formate dehydrogenase large subunit; Ortholog of Bordetella pertussis (BX470248) BP1472; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Bordetella pertussis 18323

fdhA - annotation not available

Bordetella pertussis Tohama

fdhA - annotation not available

Bordetella petrii

fdhA - Formate dehydrogenase, alpha subunit; Anaerobic dehydrogenases typically selenocysteine-containing; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Burkholderia cenocepacia

fdhA - annotation not available

Burkholderia mallei

fdhA - Glutathione-independent formaldehyde dehydrogenase; Identified by similarity to SP:P46154; match to protein family HMM PF00107

Burkholderia oklahomensis

fdhA - fdhA_non_GSH: formaldehyde dehydrogenase, glutathione-independent

Burkholderia pseudomallei ABCPW111

fdhA - fdhA_non_GSH: formaldehyde dehydrogenase, glutathione-independent

Burkholderia pseudomallei K96243

fdhA - Similar to Pseudomonas putida glutathione-independent formaldehyde dehydrogenase FdhA SWALL:FADH_PSEPU (SWALL:P46154) (398 aa) fasta scores: E(): 1.2e-121, 80.9% id in 398 aa, and to Ralstonia solanacearum probable glutathione-independent formaldehyde dehydrogenase oxidoreductase protein rsp0053 or rs02028 SWALL:Q8XTQ3 (EMBL:AL646076) (398 aa) fasta scores: E(): 2e-142, 92.98% id in 399 aa

Burkholderia xenovorans

fdhA - annotation not available

Campylobacter coli 76339

fdhA - annotation not available

Campylobacter cuniculorum

fdhA - annotation not available

Campylobacter jejuni 81176

fdhA - Formate dehydrogenase, alpha subunit, selenocysteine-containing; Identified by match to protein family HMM PF00384; match to protein family HMM PF01568; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Campylobacter jejuni NCTC11168

fdhA - Original (2000) note: Cj1511c, fdhA, probable formate dehydrogenase large subunit, len: 934 aa; similar to e.g. TR:P28179 (EMBL:X54057) Wolinella succinogenes formate dehydrogenase large subunit precursor (EC 1.2.1.2)(939 aa), fasta scores; opt: 3368 z-score: 3913.9 E(): 7.3e-211, 52.8% identity in 930 aa overlap, and FDHF_ECOLI formate dehydrogenase H (EC 1.2.1.2) (formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide) (715 aa), fasta scores; opt: 813 z-score: 943.1 E(): 2.2e-45, 30.9% identity in 696 aa overlap. No Hp match. Contains Pfam match to entry PF00384 molybdo [...]

Campylobacter lari

fdhA - Formate dehydrogenase, alpha subunit (Selenocysteine-containing); Pfam matches to PF04879.7 Molybdop_Fe4S4, and to PF00384.13 Molybdopterin; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Campylobacter upsaliensis

fdhA - Formate dehydrogenase, alpha subunit, selenocysteine-containing; Selenoprotein.identified by similarity to SP:P07658; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Campylobacter ureolyticus

fdhA - annotation not available

Carboxydothermus hydrogenoformans

fdhA - NAD-dependent formate dehydrogenase, alpha subunit, selenocysteine-containing; Selenoprotein; identified by match to protein family HMM PF00037; match to protein family HMM PF00111; match to protein family HMM PF00384; match to protein family HMM PF01568; match to protein family HMM PF04879; match to protein family HMM TIGR01591

Cesiribacter andamanensis

fdhA - annotation not available

Chlamydia sp. Rubis

fdhA - annotation not available

Citreicella sp. SE45

fdhA - annotation not available

Clostridium acidurici

fdhA - NADP-dependent formate dehydrogenase FdhA; Normal

Clostridium litorale

fdhA - annotation not available

Clostridium ljungdahlii

fdhA - Predicted formate dehydrogenase, alpha subunit; Selenoprotein; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Clostridium sticklandii

fdhA - Formate dehydrogenase alpha chain; Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type e : enzyme; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Collimonas fungivorans

fdhA - annotation not available

Corallococcus coralloides

fdhA - annotation not available

Corynebacterium imitans

fdhA - Formate dehydrogenase alpha subunit; Derived by automated computational analysis using gene prediction method: Protein Homology

Cupriavidus metallidurans

fdhA - annotation not available

Cycloclasticus zancles

fdhA - annotation not available

Desulfotomaculum hydrothermale

fdhA - annotation not available

Desulfovibrio gigas

fdhA - annotation not available

Desulfovibrio hydrothermalis

fdhA - annotation not available

Desulfovibrio magneticus RS1

fdhA - annotation not available

Dinoroseobacter shibae

fdhA - Formate dehydrogenase, alpha subunit; Complex with fdhB, Molybdopterin oxidoreductase, contains Fe-S clusters; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Enterococcus faecalis V583

fdhA - NAD-dependent formate dehydrogenase, alpha subunit; Similar to GP:1658403, and GP:3724145; identified by sequence similarity; putative

Ferrimicrobium acidiphilum

fdhA - annotation not available

Gordonia sputi

fdhA - annotation not available

Haloarcula hispanica

fdhA - annotation not available

Haloferax volcanii

fdhA - Formate dehydrogenase alpha subunit; COG0243 Anaerobic dehydrogenases, typically selenocysteine-containing

Halomonas elongata

fdhA - Glutathione-independent formaldehyde dehydrogenase -Pseudomonas aeruginosa,InterPro: Zinc-containing alcohol dehydrogenase superfamily, High confidence in function and specificity

Halomonas sp. HL48

fdhA - annotation not available

Kocuria rhizophila DC2201

fdhA - annotation not available

Luminiphilus syltensis

fdhA - Formate dehydrogenase, alpha subunit; [C] COG0243 Anaerobic dehydrogenases, typically selenocysteine-containing; overlaps another CDS with the same product name; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Martelella mediterranea

fdhA - annotation not available

Methanobrevibacter sp. AbM4

fdhA - annotation not available

Methanocella conradii

fdhA - IMG term: formate dehydrogenase, alpha subunit (F420) (EC 1.2.99.-)

Methanosphaera stadtmanae

fdhA - FdhA; Putative formate dehydrogenase, alpha subunit

Microlunatus phosphovorus

fdhA - annotation not available

Mitsuokella jalaludinii

fdhA - annotation not available

Mycobacterium phlei

fdhA - Glutathione-independent formaldehyde dehydrogenase; COG1063 Threonine dehydrogenase and related Zn-dependent dehydrogenases

Natronomonas moolapensis

fdhA - annotation not available

Natronomonas pharaonis

fdhA - IS1341-type transposase ISNph15; Locus_tag: NP_3710A; product: formate dehydrogenase alpha subunit (nonfunctional); gene has been targetted by a transposon; conceptual translation after in silico reconstruction: MSSDPSEPTETICPYCGVGCGIKITQDTDDPGDVQFMPWGEAPVN EGRVCIKGGAATEVIDHEDRLTEPLIKDGEEFREASWEECYEYIVAELERIRDEYGPD AMGFFGSSKTMNEGNYLFQKLARRYGTNNVDNCTRMCHASTVWALRTSLGMGAMTNSM EDIRESADLLWIQGANPGEQHPIATSQYLRQAALDGATVIQVDPHANGTTESLEVEAT DRHQHLQLNPGTDIPLLNVVLKTILDHHAEHPEDGWVDASFVESRTEGFEDLQATLDG FDAQAAAEECGVPLEDIQRAAKKYATADNAAIFTGMGMSQHACGVDNVQNEINLALIT GNVGRPGTGINPLRGQNNVQGTCDVGVMPNVLPGYQLVD [...]

Nocardia nova

fdhA - annotation not available

Ochrobactrum rhizosphaerae

fdhA - annotation not available

Oligotropha carboxidovorans

fdhA - annotation not available

Pelagibacter sp. HTCC7211

fdhA - Formate dehydrogenase, alpha subunit; [C] COG0243 Anaerobic dehydrogenases, typically selenocysteine-containing

Photobacterium leiognathi mandapamensis

fdhA - annotation not available

Photobacterium phosphoreum

fdhA - annotation not available

Planktomarina temperata

fdhA - annotation not available

Pseudomonas aeruginosa

fdhA - fdhA_non_GSH: formaldehyde dehydrogenase, glutathione-independent

Pseudomonas entomophila

fdhA - Formaldehyde dehydrogenase, glutathione-independent; Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type e : enzyme

Pseudomonas fluorescens F113

fdhA - FdhA; Glutathione-independent formaldehyde dehydrogenase; Protein involved in formaldehyde dehydrogenase activity, zinc ion binding, oxidation reduction and formaldehyde metabolic process

Pseudomonas fluorescens NZ007

fdhA - annotation not available

Pseudomonas fluorescens Pf01

fdhA - annotation not available

Pseudomonas fluorescens Q287

fdhA - Formaldehyde dehydrogenase, glutathione-independent; Identified by similarity to SP:P46154; match to protein family HMM PF00107; match to protein family HMM PF08240; match to protein family HMM TIGR02819

Pseudomonas fluorescens SBW25

fdhA - annotation not available

Pseudomonas knackmussii

fdhA - annotation not available

Pseudomonas nitroreducens HBP1

fdhA - annotation not available

Pseudomonas nitroreducens TX1

fdhA - annotation not available

Pseudomonas poae

fdhA - Formaldehyde dehydrogenase, glutathione-independent; COG1063 Threonine dehydrogenase and related Zn-dependent dehydrogenases

Pseudomonas protegens CHA0

fdhA - annotation not available

Pseudomonas protegens Pf5

Pseudomonas pseudoalcaligenes CECT5344

fdhA - Glutathione-independent formaldehyde dehydrogenase; Threonine dehydrogenase and related Zn-dependent dehydrogenases

Pseudomonas putida KT2440

fdhA - Formaldehyde dehydrogenase; Similar to SP:P46154, GB:X64318, GB:U26173, GB:S79880, PID:1237118, and PID:30956; identified by sequence similarity; putative

Pseudomonas putida MTCC5279

fdhA - Glutathione-independent formaldehyde dehydrogenase; Catalyzes the NAD(+)-dependent oxidation of formaldehyde and acetoaldehyde, and, to a lesser extent, long-chain alcohols, but is inactive against propionaldehyde, butyraldehyde, methanol and ethanol. Can also catalyze the dismutation of a wide range of aldehydes such as formaldehyde; Belongs to the zinc-containing alcohol dehydrogenase family

Pseudomonas putida NBRC14164

fdhA - annotation not available

Pseudomonas resinovorans NBRC106553

fdhA - annotation not available

Pseudomonas sp. RIT357

fdhA - annotation not available

Pseudomonas sp. UW4

fdhA - [ER] COG1063 Threonine dehydrogenase and related Zn-dependent dehydrogenases

Ralstonia solanacearum GMI1000

fdhA - Probable glutathione-independent formaldehyde dehydrogenase oxidoreductase protein; Small molecule metabolism; degradation; carbon compounds

Ralstonia solanacearum Po82

fdhA - annotation not available

Rhizobium gallicum

fdhA - annotation not available

Rhizobium mesoamericanum

fdhA - annotation not available

Rhodobacter capsulatus

fdhA - annotation not available

Rhodobacteraceae bacterium HTCC2083

fdhA - Formate dehydrogenase, alpha subunit; [C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)

Rhodobacteraceae bacterium KLH11

fdhA - Formate dehydrogenase, alpha subunit; [C] COG0243 Anaerobic dehydrogenases, typically selenocysteine-containing; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Rhodobacterales bacterium Y4I

fdhA - Formate dehydrogenase, alpha subunit; [C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G); Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Rhodospirillum photometricum

fdhA - annotation not available

Roseobacter litoralis

fdhA - annotation not available

Roseobacter sp. GAI101

fdhA - Formate dehydrogenase, alpha subunit; [C] COG0243 Anaerobic dehydrogenases, typically selenocysteine-containing; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Ruegeria sp. R11

Saccharopolyspora erythraea

fdhA - Glutathione-independent formaldehyde dehydrogenase; Threonine dehydrogenase

Scalindua brodae

fdhA - annotation not available

Sinorhizobium fredii HH103

fdhA - Formaldehyde dehydrogenase,glutathione-independent; Threonine dehydrogenase and related Zn-dependent dehydrogenases

Sphingomonas sp. S17

fdhA - [ER] COG1063 Threonine dehydrogenase and related Zn-dependent dehydrogenases

Sporosarcina newyorkensis

fdhA - NAD-dependent formate dehydrogenase, alpha subunit; COG: COG3383

Staphylococcus pseudintermedius

fdhA - Formate dehydrogenase related protein; Identified by match to protein family HMM PF00037, match to protein family HMM PF00111, match to protein family HMM PF00384, match to protein family HMM PF01568, match to protein family HMM PF04879, match to protein family HMM TIGR01591

Streptomyces avermitilis

fdhA - Putative glutathione-independent formaldehyde dehydrogenase; PF00107: Zinc-binding dehydrogenase

Sulfobacillus acidophilus

fdhA - annotation not available

Sulfurimonas gotlandica

fdhA - annotation not available

Thermococcus gammatolerans

fdhA - Formate dehydrogenase alpha subunit (FdhA); 2 probable transmembrane helices predicted by modhmm

Thiomonas arsenitoxydans

fdhA - Formate dehydrogenase, alpha subunit FdnA; Evidence 2b : Function of strongly homologous gene; Product type e : enzyme; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Treponema primitia ZAS2

fdhA - Formate dehydrogenase, alpha subunit; Identified by match to protein family HMM PF00384; match to protein family HMM PF01568; match to protein family HMM PF04879; match to protein family HMM TIGR01591; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Turicella otitidis

fdhA - annotation not available

Vibrio nigripulchritudo

fdhA - Formate dehydrogenase subunit A; Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type e : enzyme; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family

Xanthomonas campestris campestris

fdhA - Formate dehydrogenase related protein; Anaerobic dehydrogenases, typically selenocysteine-containing

Yersinia aldovae

fdhA - L-seryl-tRNA(Sec) selenium transferase; Converts seryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis; Belongs to the SelA family

Yersinia intermedia

fdhA - L-seryl-tRNA(Sec) selenium transferase; Converts seryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis; Belongs to the SelA family

Yersinia massiliensis

fdhA - L-seryl-tRNA(Sec) selenium transferase; Converts seryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis; Belongs to the SelA family

Yersinia pestis CO92

fdhA - L-seryl-tRNA(Sec) selenium transferase; Converts seryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis; Belongs to the SelA family

beta proteobacterium KB13

fdhA - Formate dehydrogenase, alpha subunit; [C] COG0243 Anaerobic dehydrogenases, typically selenocysteine-containing

Agrobacterium tumefaciens Cherry

H009_24846 - Glutathione-independent formaldehyde dehydrogenase; COG1063 Threonine dehydrogenase and related Zn-dependent dehydrogenases [a.k.a. fdhA, EMS94877.1, atf:Ach5_15070]

Amycolatopsis methanolica

AMETH_1319 - annotation not available [a.k.a. fdhA, AIJ21411.1, 672355533]

Amycolatopsis methanolica

AMETH_3094 - annotation not available [a.k.a. fdhA, AIJ23186.1, A0A076MVX8_AMYME]

Aromatoleum aromaticum

ebA2749 - annotation not available [a.k.a. fdhA, CAI07668.1, InterPro:IPR001041]

Aromatoleum aromaticum

ebA2936 - annotation not available [a.k.a. fdhA, CAI07775.1, IPR006656]

Arthrobacter aurescens

AAur_0480 - Glutathione-independent formaldehyde dehydrogenase; Identified by match to protein family HMM PF00107; match to protein family HMM TIGR02819 [a.k.a. fdhA, ABM07477.1, aau:AAur_0480]

Arthrobacter aurescens

AAur_1867 - Glutathione-independent formaldehyde dehydrogenase; Identified by match to protein family HMM PF00107 [a.k.a. fdhA, ABM08055.1, aau:AAur_1867]

Azoarcus sp. KH32C

AZKH_0075 - annotation not available [a.k.a. fdhA, BAL22422.1, aza:AZKH_0075]

Azoarcus sp. KH32C

AZKH_4498 - annotation not available [a.k.a. fdhA, BAL26771.1, 358639474]

Azoarcus sp. KH32C

AZKH_p0512 - annotation not available [a.k.a. fdhA, BAL27395.1, H0Q5Y2_9RHOO]

Burkholderia cenocepacia

selA - L-seryl-tRNA(Sec) selenium transferase; Converts seryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis [a.k.a. BCAM1022, CAR54878.1, GI:198038916, fdhA]

Burkholderia cenocepacia

selB - annotation not available [a.k.a. BCAM1023, CAR54879.1, InterPro:IPR004161, fdhA]

Burkholderia cepacia

WI67_29530 - fdhA_non_GSH: formaldehyde dehydrogenase, glutathione-independent [a.k.a. WL94_35740, CEQ23_34435, fdhA]

Burkholderia cepacia

DM42_674 - annotation not available [a.k.a. fdhA, AIO46910.1, GI:685659783]

Burkholderia multivorans

Bmul_2366 - TIGRFAM: formate dehydrogenase, alpha subunit; PFAM: ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding domain protein; molybdopterin oxidoreductase; molydopterin dinucleotide-binding region; molybdopterin oxidoreductase Fe4S4 region; KEGG: bch:Bcen2424_1031 formate dehydrogenase, alpha subunit [a.k.a. BMULJ_00875, fdhA, ABX16051.1]

Burkholderia multivorans

Bmul_4597 - TIGRFAM: formate dehydrogenase, alpha subunit; PFAM: molybdopterin oxidoreductase; molydopterin dinucleotide-binding region; KEGG: bvi:Bcep1808_4486 formate dehydrogenase, alpha subunit; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. fdhA, BMULJ_03913, ABX18275.1]

Burkholderia pseudomallei K96243

selB - Similar to Escherichia coli selenocysteine-specific elongation factor SelB or FdhA or b3590 SWALL:SELB_ECOLI (SWALL:P14081) (614 aa) fasta scores: E(): 1.4e-43, 42.45% id in 636 aa, and to Pseudomonas aeruginosa selenocysteine-specific elongation factor SelB or pa4807 SWALL:Q9HV02 (EMBL:AE004893) (641 aa) fasta scores: E(): 5.8e-97, 49.76% id in 639 aa [a.k.a. BPSS1662, CAH39136.1, selenocysteine-specific elongation factor, fdhA]

Burkholderia pseudomallei K96243

selA - L-seryl-tRNA(Sec) selenium transferase; Converts seryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis [a.k.a. BPSS1663, CAH39137.1, selenocysteine synthase, fdhA]

Desulfococcus multivorans

dsmv_1220 - PFAM: molybdopterin oxidoreductase, molybdopterin dinucleotide-binding region; KEGG: dat:HRM2_16870 FdhA5; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. fdhA, EPR43194.1, EPR43194]

Desulfovibrio piezophilus

BN4_11195 - Formate dehydrogenase subunit alpha; Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type e : enzyme; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. fdhA, CCH48432.1, CCH48432]

Desulfovibrio piezophilus

BN4_12493 - Formate dehydrogenase, alpha subunit Selenocysteine containing protein, fused to 12494; Evidence 1c : Function experimentally demonstrated in the studied genus; Product type e : enzyme; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. fdhA, CCH49728.1, 451896849]

Desulfovibrio piezophilus

BN4_20159 - annotation not available [a.k.a. fdhA, CCH50221.1, Formate dehydrogenase subunit alpha]

Escherichia coli K12 W3110

Heliobacterium modesticaldum

HM1_1745 - annotation not available [a.k.a. fdhA, ABZ84315.1, 1.17.1.10]

Heliobacterium modesticaldum

HM1_2785 - annotation not available [a.k.a. fdhA, ABZ85314.1, hmo:HM1_2785]

Methanococcus maripaludis S2

MMP0138 - Formate dehydrogenase alpha subunit; Contains selenocysteine; Citation: J. Bacteriol. 185:2548 [a.k.a. fdhA, CAF29694.1, UniProtKB/TrEMBL:Q877E3]

Methanococcus maripaludis S2

MMP1298 - Formate dehydrogenase alpha subunit; Contains selenocysteine; Citation: J. Bacteriol 185:2548 [a.k.a. fdhA, CAF30854.1, IPR006656]

Methylomirabilis oxyfera

DAMO_0853 - Formate dehydrogenase, alpha subunit (FdhA2); Evidence 2b : Function of strongly homologous gene; Product type e : enzyme; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. fdhA, CBE67914.1, InterPro:IPR001041]

Methylomirabilis oxyfera

DAMO_1138 - Formate dehydrogenase, alpha subunit (FdhA1); Evidence 2b : Function of strongly homologous gene; Product type e : enzyme [a.k.a. fdhA, CBE68198.1, InterPro:IPR001041]

Moorella thermoacetica

Moth_2193 - Formate dehydrogenase, alpha subunit (F420); Contains selenocysteine; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. fdhA, ABC20482.2, Q2RGF7_MOOTA]

Moorella thermoacetica

Moth_2312 - Formate dehydrogenase alpha subunit; Contains selenocysteine [a.k.a. fdhA, ABC20599.2, ABC20599]

Ralstonia solanacearum PSI07

CBJ50454.1 - Formate dehydrogenase, alpha subunit (Fe4S4 domain); Evidence 2b : Function of strongly homologous gene; Product type e : enzyme; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. RPSI07_1095, fdhA, GI:299077816]

Ralstonia solanacearum PSI07

CBJ35412.1 - Evidence 2b : Function of strongly homologous gene; Product type e : enzyme; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. fdhA, RPSI07_mp1081, IPR006656]

Roseobacter denitrificans

RD1_2897 - annotation not available [a.k.a. fdhA, ABG32421.1, Q165C2]

Roseobacter denitrificans

RD1_4234 - annotation not available [a.k.a. fdhA, ABG33670.1, rde:RD1_4234]

Shewanella oneidensis

SO_4509 - annotation not available [a.k.a. fdhA, AAN57473.1, WP_011074128.1]

Shewanella oneidensis

SO_4513 - annotation not available [a.k.a. fdhA, AAN57477.1, AAN57477]

Thermoproteus tenax

TTX_1203 - annotation not available [a.k.a. fdhA, CCC81843.1, G4RJU8]

Thermoproteus tenax

TTX_1269 - annotation not available [a.k.a. fdhA, CCC81903.1, 350275256]

Wolinella succinogenes

WS0029 - FORMATE DEHYDROGENASE LARGE SUBUNIT PRECURSOR; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. FDHA, NP_906302.1, Q7MAT9]

Wolinella succinogenes

psrA - Polysulfide reductase chain A; Component of the phosphorylative electron transport system with polysulfide as the terminal acceptor [a.k.a. WS0116, fdhA, NP_906381.1]

Wolinella succinogenes

WS0709 - annotation not available [a.k.a. fdhA, NP_906934.1, THIOSULFATE REDUCTASE]

Wolinella succinogenes

WS0733 - FORMATE DEHYDROGENASE LARGE SUBUNIT PRECURSOR; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. FDHA, NP_906953.1, wsu:WS0733]

Wolinella succinogenes

WS1146 - annotation not available [a.k.a. FDHA, NP_907333.1, Q7M971]

Wolinella succinogenes

WS1572 - annotation not available [a.k.a. fdhA, NP_907712.1, Hypothetical protein]

Yersinia enterocolitica 8081

selA - L-seryl-tRNA(Sec) selenium transferase; Converts seryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis; Belongs to the SelA family [a.k.a. YE4131, CAL14148.1, A1JT25, fdhA]

Arcobacter nitrofigilis

Arnit_0966 - Molybdopterin oxidoreductase Fe4S4 region; COGs: COG3383 Uncharacterized anaerobic dehydrogenase; InterProIPR006963:IPR006656:IPR006655:IPR006311:IPR 017909; KEGG: abu:Abu_1498 formate dehydrogenase, large subunit FdhA; PFAM: molybdopterin oxidoreductase Fe4S4 region; molybdopterin oxidoreductase; SPTR: A8EUX9 Formate dehydrogenase, large subunit FdhA; PFAM: Molybdopterin oxidoreductase; Molybdopterin oxidoreductase Fe4S4 domain [a.k.a. ADG92630.1, GI:296096680, 296096680]

Butyrivibrio crossotus

EFF68306.1 - SpoIID/LytB domain protein; KEGG: mst:Msp_0640 0.0075 fdhA; FdhA K00123 [a.k.a. BUTYVIB_01577, InterPro:IPR013486, GI:292809101]

Clostridium spiroforme

EDS74363.1 - Uncharacterized protein; KEGG: mst:Msp_0640 0.00053 fdhA; FdhA K00123; COG: COG4608 ABC-type oligopeptide transport system, ATPase component [a.k.a. CLOSPI_01947, EDS74363, Hypothetical protein]

Agrobacterium sp. H133

ADY67911.1 - Alcohol dehydrogenase GroES-like domain, fdhA_non_GSH: formaldehyde dehydrogenase, glutathione-independent; Threonine dehydrogenase and related Zn- dependent dehydrogenases [a.k.a. AGROH133_14499, GI:325064222, agr:AGROH133_14499]

Aliivibrio salmonicida

CAQ81152.1 - NAD-dependent formate dehydrogenase alpha subunit; Similar to Eubacterium acidaminophilum FdhA-I protein UniProt:Q93V06 (893 aa) fasta scores: E()=1.3e-116, 46.485% id in 882 aa; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. VSAL_II0398, InterPro:IPR009051, InterPro:IPR001041]

Arcobacter butzleri RM4018

Abu_1498 - Formate dehydrogenase, large subunit FdhA; Pfam match to PF00384 Molybdopterin, score 142, E-value 2E-034; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. ABV68544.1, ABV68544, A8EUX9_ARCB4]

Arcobacter butzleri RM4018

fdhA2 - Formate dehydrogenase, large subunit FdhA (Cysteine containing); Pfam matches to PF00384 Molybdopterin, score 181.1, E-value 1.2E-051, and to PF01568 Molydop_binding, score 60.5, E-value 3.7E-016, and to PF04879 Molybdop_Fe4S4, score 62.3, E-value 1.4E-015, and to PF00384 Molybdopterin, score 43.1, E-value 2.1E-012; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. Abu_1511, ABV67765.1, 24305348]

Azoarcus sp. BH72

fdhC - Putative formate dehydrogenase gamma subunit. Homology to fdhC of W. succinogenes of 21% (TREMBL:P28180). Formate dehydrogenase is a membrane-bound complex, formed of at least three different subunits; probable heterotetramer of two FDHA, one FDHB and one FDHC. FdhC probably anchors the enzyme in the membrane and IS PROBABLY THE CYTOCHROME B556(FDO) COMPONENT. no good domains signal peptide 5 TMHs; Family membership [a.k.a. azo3479, CAL96095.1, A1KB89]

Azoarcus sp. BH72

fdhA2 - Probable formate dehydrogenase alpha subunit. Homology to fdha of W. succinogenes of 44% (pir|S18213) The formate dehydrogenase catalyzes the oxidation of formate (produced from pyruvate during anaerobic growth) to carbon dioxide with the concomitant release of two electrons and two protons. The electrons are utilized mainly in the nitrate respiration by nitrate reductase InterPro: Prokaryotic molybdopterin oxidoreductases (IPR006655) Pfam: Molybdopterin oxidoreductase; Molydopterin dinucleotide binding domain singal peptide no TMHs; High confidence in function and specificity [a.k.a. azo3482, CAL96098.1, 119672184]

Blautia hydrogenotrophica

EEG50436.1 - Uncharacterized protein; KEGG: efa:EF1390 1.5e-238 fdhA; NAD-dependent formate dehydrogenase, alpha subunit K00123; Psort location: Cytoplasmic, score: 8.87 [a.k.a. RUMHYD_00602, 225040190, InterPro:IPR001041]

Burkholderia pseudomallei K96243

BPSS2235 - Putative Zinc-binding dehydrogenase; Similar to Methylobacter marinus glutathione-dependent formaldehyde dehydrogenase Fdh SWALL:FADH_METMR (SWALL:P47734) (424 aa) fasta scores: E(): 1.8e-78, 53.07% id in 390 aa, and to Pseudomonas putida glutathione-independent formaldehyde dehydrogenase FdhA SWALL:FADH_PSEPU (SWALL:P46154) (398 aa) fasta scores: E(): 4.7e-20, 32.5% id in 403 aa [a.k.a. CAH39721.1, IPR016040, IPR011032]

Burkholderia sp. lig30

LIG30_0145 - TIGRFAM: formaldehyde dehydrogenase, glutathione-independent; KEGG: fdhA, glutathione-independent formaldehyde dehydrogenase; PFAM: Alcohol dehydrogenase GroES domain protein, Alcohol dehydrogenase zinc-binding domain protein [a.k.a. KDB08267.1, 632870699, IPR013149]

Clostridium bolteae

EDP18150.1 - Uncharacterized protein; KEGG: efa:EF1390 4.0e-270 fdhA; NAD-dependent formate dehydrogenase, alpha subunit K00123; COG: COG3383 Uncharacterized anaerobic dehydrogenase; Psort location: Cytoplasmic, score:8.87; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. CLOBOL_01504, Hypothetical protein, IPR006656]

Clostridium scindens

EDS05439.1 - 4Fe-4S binding domain protein; KEGG: chy:CHY_0733 7.8e-24 fdhA; NAD-dependent formate dehydrogenase, alpha subunit, selenocysteine-containing K00123; COG: COG3383 Uncharacterized anaerobic dehydrogenase; Psort location: CytoplasmicMembrane, score: 7.80 [a.k.a. CLOSCI_03473, InterPro:IPR001041, WP_004608137.1]

Dorea longicatena DSM13814

EDM63435.1 - Uncharacterized protein; KEGG: cjr:CJE1684 0.55 fdhA; formate dehydrogenase, alpha subunit, selenocysteine-containing [a.k.a. DORLON_01101, Hypothetical protein, A6BFM8]

Halomonas sp. KO116

KFC12545.1 - TIGRFAM: formate dehydrogenase, alpha subunit; PFAM: molybdopterin oxidoreductase, 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein, molybdopterin oxidoreductase Fe4S4 region, molybdopterin dinucleotide-binding region, NADH:ubiquinone oxidoreductase, subunit G, iron-sulfur binding protein; KEGG: fdhA, formate dehydrogenase; SMART: molybdopterin oxidoreductase Fe4S4 region, NADH:ubiquinone oxidoreductase, subunit G, iron-sulfur binding protein [a.k.a. KO116_P100147, KO116_1621, AJY52904]

Halomonas sp. KO116

KFC10370.1 - TIGRFAM: formaldehyde dehydrogenase, glutathione-independent; KEGG: fdhA, glutathione-independent formaldehyde dehydrogenase; PFAM: Alcohol dehydrogenase GroES domain protein, Alcohol dehydrogenase zinc-binding domain protein [a.k.a. KO116_00524, KO116_3285, WP_035560536.1]

Ilyobacter polytropus

Ilyop_0634 - NAD-dependent formate dehydrogenase catalytic subunit; COGs: COG3383 Uncharacterized anaerobic dehydrogenase; Contains selenocysteine; InterProIPR001041:IPR019574:IPR001450:IPR006963:IPR 006656:IPR006657:IPR017900:IPR006655:IPR017896:IPR006478:I PR009010; KEGG: aoe:Clos_2249 formate dehydrogenase, alpha subunit; PFAM: molybdopterin oxidoreductase; molybdopterin oxidoreductase Fe4S4 region; NADH:ubiquinone oxidoreductase, subunit G, iron-sulphur binding; ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding domain protein; molydopterin dinucleotide-binding region; SPTR: Q93V05 FdhA-II prote [...] [a.k.a. ADO82421.1, GI:309747759, ADO82421]

Methanobacterium paludis

MSWAN_0116 - TIGRFAM: Formate dehydrogenase, alpha subunit; KEGG: msi:Msm_1404 formate dehydrogenase, alpha subunit, FdhA; PFAM: Molybdopterin oxidoreductase; Molybdopterin oxidoreductase Fe4S4 region; Molydopterin dinucleotide-binding region [a.k.a. AEG17163.1, F6D818, IPR006656]

Methanobrevibacter smithii ATCC35061

Msm_1404 - Formate dehydrogenase, alpha subunit, FdhA; COG0243 [a.k.a. ABQ87609.1, 148552481, ABQ87609]

Methanobrevibacter smithii ATCC35061

Msm_1463 - Formate dehydrogenase, alpha subunit, FdhA; COG0243 [a.k.a. ABQ87668.1, msi:Msm_1463, IPR006656]

Pelosinus sp. UFO1

UFO1_1820 - Formate dehydrogenase, alpha subunit; SMART: molybdopterin oxidoreductase Fe4S4 region; TIGRFAM: formate dehydrogenase, alpha subunit; KEGG: fdhA, formate dehydrogenase subunit alpha; PFAM: molybdopterin oxidoreductase, molybdopterin dinucleotide-binding region, molybdopterin oxidoreductase Fe4S4 region; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. AIF51371.1, WP_038670143.1, IPR006656]

Proteus penneri

EEG84974.1 - Molybdopterin oxidoreductase Fe4S4 domain protein; KEGG: aha:AHA_2495 9.0e-60 fdhA; formate dehydrogenase, alpha subunit, selenocysteine-containing K00122; Psort location: Periplasmic, score: 9.44 [a.k.a. PROPEN_03339, 225202620, IPR006656]

Providencia alcalifaciens

EEB46392.1 - Molybdopterin oxidoreductase Fe4S4 domain protein; KEGG: aha:AHA_2495 1.3e-60 fdhA; formate dehydrogenase, alpha subunit, selenocysteine-containing K00122 [a.k.a. PROVALCAL_01506, IPR006656, B6XDT1]

Providencia rustigianii

EFB72300.1 - Molybdopterin oxidoreductase Fe4S4 domain protein; KEGG: aha:AHA_2495 1.3e-60 fdhA; formate dehydrogenase, alpha subunit, selenocysteine-containing K00122 [a.k.a. PROVRUST_06369, 282566765, IPR006656]

Rhizobium sp. CF080

EUB97503.1 - TIGRFAM: formate dehydrogenase, alpha subunit; PFAM: molybdopterin oxidoreductase, molybdopterin oxidoreductase Fe4S4 region, NADH:ubiquinone oxidoreductase, subunit G, iron-sulfur binding protein, molybdopterin dinucleotide-binding region, 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein; KEGG: fdhA, formate dehydrogenase subunit alpha; SMART: NADH:ubiquinone oxidoreductase, subunit G, iron-sulfur binding protein, molybdopterin oxidoreductase Fe4S4 region [a.k.a. PMI07_000063, W6W2K9_9RHIZ, IPR006656]

Rubrobacter radiotolerans

AHY47856.1 - TIGRFAM:TIGR02819:Formaldehyde dehydrogenase, glutathione-independent; COG:COG1063: Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]; Pfam:PF08240:Alcohol dehydrogenase GroES-like; ProSitePatterns:PS00059:Alcohol dehydrogenase, zinc-type, conserved site; SUPERFAMILY:SSF51735:No Description; fdhA_non_GSH [a.k.a. RradSPS_2573, GO:0055114, 627778635]

Streptomyces coelicolor

SCO4055 - 2SCD60.21c, probable alcohol dehydrogenase, len: 377 aa; similar to SW:FADH_PSEPU (EMBL:D21201) Pseudomonas putida glutathione-independent formaldehyde dehydrogenase (EC 1.2.1.46) FdhA, 398 aa; fasta scores: opt: 1048 z-score: 1080.0 E(): 0; 47.9% identity in 390 aa overlap. Contains Pfam match to entry PF00107 adh_zinc, Zinc-binding dehydrogenases and match to Prosite entry PS00059 Zinc-containing alcohol dehydrogenases signature [a.k.a. 2SCD60.21c, NP_628237.1, WP_003974908.1]

Streptomyces coelicolor

SCO6559 - SC4B5.09c, respiratory chain oxidoreductase, len: 286 aa; similar to the N-terminal region of many proteins involved in electron transfer e.g. TR:P77908 (EMBL:U73807) FdhA formate dehydrogenase alpha subunit from Moorella thermoacetica (893 aa), fasta scores; opt: 685, z-score: 791.8, E(): 0, (38.4% identity in 284 aa overlap). Contains PS00551 Prokaryotic molybdopterin oxidoreductases signature 1, PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature, PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature, Pfam match to entry PF00037 fer4, 4Fe-4S ferredoxins and r [...] [a.k.a. SC4B5.09c, NP_630640.1, 21224861]

Streptomyces coelicolor

SCO6561 - SC4B5.11c, respiratory chain oxidoreductase, len: 642 aa; similar to the C-terminal region of many proteins involved in electron transfer e.g. TR:P77908 (EMBL:U73807) FdhA formate dehydrogenase alpha subunit from Moorella thermoacetica (893 aa) fasta scores; opt: 1532, z-score: 1338.5, E(): 0, (43.1% identity in 619 aa overlap). Contains Pfam match to entry PF00384 molybdopterin, Prokaryotic molybdopterin oxidoreductases, score 95.80, E-value 6.2e-30. Considering the corresponding homolgies, this CDS may have previously been located directly downsteam of SC4B5.09c [a.k.a. SC4B5.11c, NP_630642.1, WP_003972418.1]

Streptomyces fulvissimus

SFUL_466 - Uncharacterized protein; Catalyzes the oxidation of formate; cofactor:Zinc; UniProt-pubmed:1378430; UniProt-pubmed:18631365; UniProt-pubmed:16311624; UniProt-pubmed:21304664; UniProt-pubmed:18263724; UniProt-pubmed:18441057; pathway_coverage:02.16.13.01 conversion of CO2 to acetate; gene_name:fdha; UniProt-pubmed:3531194; pathway_coverage:02.16.09.01 conversion of pyruvateto H2 and CO2 via formate; UniProt-pubmed:12000953; UniProt-pubmed:9371463; subunit:Dimer of an alpha and a beta subunit; cofactor:Binds 1 4Fe-4S cluster (By similarity); UniProt-pubmed:20624727; UniProt-pubmed:213047 [...] [a.k.a. AGK75450.1, Oxidoreductase, Uncharacterized protein]

Streptomyces fulvissimus

SFUL_683 - Uncharacterized protein; gene_name:bisC; Putative oxidoreductase; UniProt-pubmed:16404955; pathway_coverage:02.16.13.01 conversion of CO2 to acetate; gene_name:fdhA; UniProt-pubmed:11823852; pathway_coverage:02.22.02.02 glyoxylate oxidation via oxalate and formate (herbal path); UniProt-pubmed:18375553; UniProt-pubmed:21059706; pathway_coverage:02.16.09.01 conversion of pyruvateto H2 and CO2 via formate; UniProt-pubmed:21357489; UniProt-pubmed:21148725; supfam:PIRSF000144 CbbBc; Belongs to the prokaryotic molybdopterin-containing oxidoreductase family [a.k.a. AGK75667.1, Uncharacterized protein, N0CRJ6_9ACTN]

Yersinia enterocolitica 8081

selB - Selenocysteinyl-tRNA-specific translation factor; Similar to Escherichia coli selenocysteine-specific elongation factor SelB or FdhA or b3590 SWALL:SELB_ECOLI (SWALL:P14081) (614 aa) fasta scores: E(): 5.3e-65, 63.57 id in 626 aa; Similar to Yersinia pestis selenocysteinyl-tRNA-specific translation factor SelB pseudogene [a.k.a. YE4130, CAL14147.1, 4716525]

© STRING Consortium 2019

Credits

Access

Info

About