Your Input: | |
| | Nmlp_1149 | Uncharacterized protein. (729 aa) |
| | Nmlp_1809 | ISH14-type transposase ISNamo8. (211 aa) |
| | uvrD | Repair helicase UvrD. (614 aa) |
| | lhr2 | ATP-dependent DNA helicase; Gene has a frameshift; locus_tag: Nmlp_1797; product: uncharacterized protein (nonfunctional); conceptual translation after in silico reconstruction: MVPDSPPSTLRDRLPAETESNALIYGFVGGVVGIVLSAVPLST LLGGIVAGYGGRFEDGLKAGAVAGVVTFVPFVVLFFLLLAFLGFGGAPIALGVFGAVA LVFVAAYTVGLAVLGGYLGIYIRHEL. (946 aa) |
| | mutS5b | DNA mismatch repair protein MutS. (582 aa) |
| | lhr1 | ATP-dependent DNA helicase. (950 aa) |
| | priS | DNA primase small subunit; Catalytic subunit of DNA primase, an RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. The small subunit contains the primase catalytic core and has DNA synthesis activity on its own. Binding to the large subunit stabilizes and modulates the activity, increasing the rate of DNA synthesis while decreasing the length of the DNA fragments, and conferring RNA synthesis capability. The DNA polymerase activity may enable DNA primase to also catalyze primer extension after primer synthesis. [...] (393 aa) |
| | Nmlp_1751 | IS1341-type transposase ISNamo23. (411 aa) |
| | Nmlp_1738 | Homolog to phage integrase. (336 aa) |
| | Nmlp_1728 | ISH11-type transposase ISNamo4. (330 aa) |
| | Nmlp_1726 | ISH14-type transposase ISNamo9. (211 aa) |
| | mre11 | DNA double-strand break repair protein Mre11; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Mre11 binds to DSB ends and has both double-stranded 3'-5' exonuclease activity and single-stranded endonuclease activity; Belongs to the MRE11/RAD32 family. (465 aa) |
| | rad50 | DNA double-strand break repair ATPase Rad50; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Rad50 controls the balance between DNA end bridging and DNA resection via ATP-dependent structural rearrangements of the Rad50/Mre11 complex. Belongs to the SMC family. RAD50 subfamily. (887 aa) |
| | polB | DNA-directed DNA polymerase B (intein-containing). (1376 aa) |
| | Nmlp_1689 | ISH14-type transposase ISNamo11. (211 aa) |
| | Nmlp_1678 | ISH14-type transposase ISNamo8. (211 aa) |
| | Nmlp_1673 | ISH14-type transposase ISNamo7. (211 aa) |
| | smc | Chromosome segregation protein Smc; Required for chromosome condensation and partitioning. Belongs to the SMC family. (1192 aa) |
| | nfi | Endonuclease 5; DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the intact lesion on the nicked DNA. (245 aa) |
| | Nmlp_1649 | PHP domain protein. (225 aa) |
| | Nmlp_1647 | ISH14-type transposase ISNamo13. (226 aa) |
| | Nmlp_1646 | XerC/D-like integrase. (337 aa) |
| | Nmlp_1635 | ISH9-type transposase ISNamo2; Gene has been targetted by a transposon; locus_tag: Nmlp_1634; product: sensor box histidine kinase (nonfunctional); conceptual translation after in silico reconstruction: MASEHERIDSHAVLDSLPDALFVVDRQRTISYANQRLCNVLNI SRIDLLDEPLAFLDQFVYEGFENLVSAIDEVLSGRQDDLRTEIETTLPEAAPVQQHIT VDARVTAADGNGISGALVVLRNVEEYHERQAQPRHEAQRFRTMFERHSAPMLLIDPDS GRIENANRSAVDFYGYDADRLYGMPIERINCHSPEEVSRKHKCAHRGDQNCFEFEHRL ASGETRAVEVHSSPIEIEGRTLLFSIVHDVTDRKESRRELRVFREAVAQAGHSVIITD VDGAIEYVNPAFEEVTGYDGDEIAGETPEVLNSGRRDPQFYEQLWETIRSGNVWEAEL VNQTKSGELYYAEHTIAPIVGDDGEITNFVAVQKDITERKLKQKRLSELH [...] (276 aa) |
| | Nmlp_1621 | Integrase family protein. (400 aa) |
| | rpl32e | 50S ribosomal protein L32e; Belongs to the eukaryotic ribosomal protein eL32 family. (239 aa) |
| | Nmlp_1512 | ISH14-type transposase ISNamo10. (211 aa) |
| | CCT61390.1 | IS200-type transposase ISNamo18. (127 aa) |
| | Nmlp_1510 | IS1341-type transposase ISNamo18. (411 aa) |
| | ashA | Archaea-specific helicase AshA. (675 aa) |
| | Nmlp_1438 | IS1341-type transposase ISNamo22; Product: nitroreductase family protein (nonfunctional); part of the region does not belong to this CDS as coordinates speficy only the outer boundaries; gene has been targetted by a transposon. (445 aa) |
| | Nmlp_1437 | ISH14-type transposase ISNamo12. (211 aa) |
| | Nmlp_1402 | HAD superfamily hydrolase. (208 aa) |
| | hef | ATP-dependent RNA helicase/nuclease Hef; Product: Kef-type transport system (probable substrate potassium) (nonfunctional). (835 aa) |
| | rpa2 | Replication protein A. (471 aa) |
| | nreA | DNA repair protein NreA; Involved in DNA damage repair. (426 aa) |
| | Nmlp_1336 | PHP domain protein. (256 aa) |
| | Nmlp_1286 | IS200-type transposase ISNamo19. (130 aa) |
| | Nmlp_1285 | IS1341-type transposase ISNamo19. (419 aa) |
| | Nmlp_1276 | Probable restriction/modification enzyme. (1194 aa) |
| | uvrC | UvrABC system protein C; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible for the 3' incision and the C-terminal half is responsible for the 5' incision. (576 aa) |
| | rpa3 | Replication protein A. (309 aa) |
| | priL | DNA primase large subunit; Regulatory subunit of DNA primase, an RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. Stabilizes and modulates the activity of the small subunit, increasing the rate of DNA synthesis, and conferring RNA synthesis capability. The DNA polymerase activity may enable DNA primase to also catalyze primer extension after primer synthesis. May also play a role in DNA repair. (360 aa) |
| | pcn | DNA polymerase sliding clamp; Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication. (247 aa) |
| | Nmlp_1156 | PHP domain protein. (251 aa) |
| | mutS1a | DNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. It is possible that it carries out the mismatch recognition step. This protein has a weak ATPase activity. (861 aa) |
| | Nmlp_1096 | IS1341-type transposase ISNamo20. (439 aa) |
| | radA | DNA repair and recombination protein RadA; Involved in DNA repair and in homologous recombination. Binds and assemble on single-stranded DNA to form a nucleoprotein filament. Hydrolyzes ATP in a ssDNA-dependent manner and promotes DNA strand exchange between homologous DNA molecules. (345 aa) |
| | ligA | DNA ligase (NAD); DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double- stranded DNA using NAD as a coenzyme and as the energy source for the reaction. It is essential for DNA replication and repair of damaged DNA. (690 aa) |
| | rfcA | Replication factor C small subunit; Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA; Belongs to the activator 1 small subunits family. RfcS subfamily. (324 aa) |
| | polX | DNA-directed DNA polymerase X. (580 aa) |
| | Nmlp_1031 | DEAD/DEAH box helicase. (794 aa) |
| | Nmlp_1028 | Nonhistone chromosomal protein. (103 aa) |
| | Nmlp_1019 | HAD superfamily hydrolase. (289 aa) |
| | Nmlp_1012 | IS1341-type transposase ISNamo20. (439 aa) |
| | orc1 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. (519 aa) |
| | Nmlp_2665 | IS200-type transposase ISNamo17. (129 aa) |
| | orc5 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. (405 aa) |
| | Nmlp_2656 | ISH14-type transposase ISNamo8. (211 aa) |
| | Nmlp_2651 | IS1341-type transposase ISNamo25. (410 aa) |
| | Nmlp_2646 | Homolog to restriction system mrr N-terminal region. (71 aa) |
| | Nmlp_2616 | Probable DEAD/DEAH box helicase. (817 aa) |
| | Nmlp_2611 | ISH14-type transposase ISNamo13. (226 aa) |
| | Nmlp_2605 | ISH9-type transposase ISNamo1. (271 aa) |
| | Nmlp_2597 | Integrase family protein. (424 aa) |
| | Nmlp_2590 | ISH14-type transposase ISNamo13. (226 aa) |
| | Nmlp_2586 | ISH14-type transposase ISNamo7. (211 aa) |
| | Nmlp_2584 | Homolog to 5-methylcytosine restriction system protein McrC. (400 aa) |
| | Nmlp_2579 | ISH14-type transposase ISNamo8. (211 aa) |
| | Nmlp_2572 | IS1341-type transposase ISNamo24; Gene has been targetted by a transposon; locus_tag: Nmlp_2571; product: small CPxCG-related zinc finger protein (nonfunctional); conceptual translation after in silico reconstruction: MSTTDLSTLGDCPRCSASVTSIDVLIEYKIDGQPAVYAVHAEC PGCQAVIKPA. (434 aa) |
| | Nmlp_2565 | Uncharacterized protein. (96 aa) |
| | orc4 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. (315 aa) |
| | Nmlp_2509 | ISH9-type transposase NmIRS1. (287 aa) |
| | polY2 | DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis. (421 aa) |
| | Nmlp_2495 | Integrase family protein; Product: ABC-type transport system permease protein (nonfunctional). (428 aa) |
| | Nmlp_2492 | KaiC domain protein. (485 aa) |
| | Nmlp_2491 | IS1341-type transposase ISNamo20. (439 aa) |
| | orc3 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. (418 aa) |
| | gyrA | DNA gyrase subunit A; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state. Negative supercoiling favors strand separation, and DNA replication, transcription, recombination and repair, all of which involve strand separation. Also able to catalyze the interconversion of other topological isomers of dsDNA rings, including catenanes and knotted rings. Type II topoisomerases break and join 2 DNA strands simultaneously in an ATP-dependent manner. (848 aa) |
| | gyrB | DNA gyrase subunit B; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state. Negative supercoiling favors strand separation, and DNA replication, transcription, recombination and repair, all of which involve strand separation. Also able to catalyze the interconversion of other topological isomers of dsDNA rings, including catenanes and knotted rings. Type II topoisomerases break and join 2 DNA strands simultaneously in an ATP-dependent manner. (639 aa) |
| | top6A | DNA topoisomerase 6 subunit A; Relaxes both positive and negative superturns and exhibits a strong decatenase activity; Belongs to the TOP6A family. (370 aa) |
| | dnaG | DNA primase DnaG; RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. (514 aa) |
| | mutY | A/G-specific adenine glycosylase. (339 aa) |
| | zim | CTAG modification methylase. (367 aa) |
| | Nmlp_2167 | Integrase family protein. (368 aa) |
| | topA | DNA topoisomerase 1; Releases the supercoiling and torsional tension of DNA, which is introduced during the DNA replication and transcription, by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA- (5'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 3'-OH DNA strand. The free DNA strand then undergoes passage around the unbroken strand, thus removing DNA supe [...] (849 aa) |
| | fen1 | Flap endonuclease Fen1; Structure-specific nuclease with 5'-flap endonuclease and 5'- 3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. Binds the unpaired 3'-DNA end and kinks the DNA to facilitate 5' cleavage specificity. Cleaves one nucleotide into the double-stranded DNA from the junction in flap DNA, leaving a nick for ligation. Also involved in the base excision repair (BER) pathway [...] (327 aa) |
| | Nmlp_1933 | ISH9-type transposase ISNamo1. (271 aa) |
| | Nmlp_1924 | HAD superfamily hydrolase. (217 aa) |
| | Nmlp_1923 | YfiH family protein. (263 aa) |
| | Nmlp_1910 | Gene has been targetted by a transposon; locus_tag: Nmlp_1911; product: IS1341-type transposase ISNamo20 (nonfunctional); conceptual translation after in silico reconstruction: MLEIHRTHRAKILNHSQVEDPLDRHGWSASKLWNVANYHSRQK WDDTGEIPDHSDLKDELKGHSKYKGLHSQSSQRVLEELAEAFNSWYEKRKSDNRANPP GYRKKNYYDDHGNRVHEEHPRSTVTWKQNGIKHDTKNNRVRLSKGSNHKEHPKAWEYI LVEYETRPGVTVENLQQVRAVYDKAKRRWELHLVCKDEIETPTAPGNETAGIDLGICN FAAVAYSTEQADLYPGNRLKQDGYYFPKEIAKCDDSGGKEAPRLHAKWSERRTHFFHS LSKHIVQRCIERGVGRINIGKLAGVREDDNGEAKNWGRHGNLDLHGWAFDRFTSILEY KAEVEGVEVVEVSERDTSKTCCVCGREDESQRVERGLYVCEPCDAVFNADVNGAENIR LELKQSNSESAPDLGGD [...] (211 aa) |
| | Nmlp_1905 | IS1341-type transposase ISNamo23. (411 aa) |
| | Nmlp_1853 | IS1341-type transposase ISNamo21; Gene has been targetted by a transposon; locus_tag: Nmlp_1855; conceptual translation after in silico reconstruction: MSTDNSDDTTEHHAHEHRDVGGPGYPTPAAMRTESGREQTAYV MAPRVGMQNDGPGFVGVVDLDPASDTYSELIDTVEMPNKGDELHHFGWNACSSSCHAE GLSRQYLIVPGQRSSRIHVIDAEEPRDPEIVTVIEPEELFEYDLSAPHTVHCVPGGKI VISMLGDADGELPGGFLQLDQEDFSIDGRWEADRGAMEMNYDYWYQPRYDVLISSEWA APNTYYPGFDLDDVEAGNYGDSIHIWSWDDREHVQTLEFGDAGRIPLEVRMSHNPEET QGYVGAALSSNIIRFYESTDGAWEWDVVIDEDPREHEDWDMPVPPLIIDILLSLDDQY LFFSNWLHGDVRMYDVSDAANPRLVDRVWAGGLFGDRQEIQDKEIRGAPQMLQLSRDG TRLYWTTSLFSSWDNQFFPEMAEEGSLMFKADVFPDEGRLDL [...] (459 aa) |
| | Nmlp_1847 | ISH14-type transposase ISNamo9. (211 aa) |
| | Nmlp_1842 | Product: thioredoxin domain protein (nonfunctional). (211 aa) |
| | nucS | Endonuclease NucS; Cleaves both 3' and 5' ssDNA extremities of branched DNA structures; Belongs to the NucS endonuclease family. (248 aa) |
| | orc2 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. (374 aa) |
| | mutS5a | DNA mismatch repair protein MutS; Has ATPase and non-specific DNA-binding activities. Belongs to the DNA mismatch repair MutS family. Archaeal Muts2 subfamily. (678 aa) |
| | Nmlp_3946 | Integrase family protein. (287 aa) |
| | polD2 | DNA-directed DNA polymerase D large subunit (intein-containing); Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase. (1486 aa) |
| | polD1 | DNA-directed DNA polymerase D exonuclease subunit DP1; Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3' to 5' direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase; Belongs to the DNA polymerase delta/II small subunit family. (642 aa) |
| | uvrA | UvrABC system protein A; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrA is an ATPase and a DNA-binding protein. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnormalities. When the presence of a lesion has been verified by UvrB, the UvrA molecules dissociate. (977 aa) |
| | hel308a | ATP-dependent DNA helicase Hel308; DNA-dependent ATPase and 3'-5' DNA helicase that may be involved in repair of stalled replication forks. (769 aa) |
| | ogt | Probable methylated-DNA--protein-cysteine methyltransferase. (153 aa) |
| | mutL | DNA mismatch repair protein MutL; This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a 'molecular matchmaker', a protein that promotes the formation of a stable complex between two or more DNA-binding proteins in an ATP-dependent manner without itself being part of a final effector complex. (700 aa) |
| | mutS1b | DNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. (922 aa) |
| | uvrB | UvrABC system protein B; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnormalities. Upon binding of the UvrA(2)B(2) complex to a putative damaged site, the DNA wraps around one UvrB monomer. DNA wrap is dependent on ATP binding by UvrB and probably causes local melting of the DNA helix, facilitating insertion of UvrB beta-hairpin between the DNA strands. Then UvrB probes one DNA strand for the presence of a lesion. If a lesion is found the UvrA subunits dissociate and [...] (683 aa) |
| | udg | uracil-DNA glycosylase. (193 aa) |
| | hjc | Holliday junction resolvase Hjc; A structure-specific endonuclease that resolves Holliday junction (HJ) intermediates during genetic recombination. Cleaves 4-way DNA junctions introducing paired nicks in opposing strands, leaving a 5'-terminal phosphate and a 3'-terminal hydroxyl group that are ligated to produce recombinant products; Belongs to the Holliday junction resolvase Hjc family. (173 aa) |
| | apn1 | Endonuclease 4; Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5'-ends that are base-free deoxyribose 5-phosphate residues. It preferentially attacks modified AP sites created by bleomycin and neocarzinostatin. (277 aa) |
| | Nmlp_3686 | Integrase family protein / sensor/bat box HTH-10 family transcription regulator. (837 aa) |
| | Nmlp_3676 | ISH9-type transposase ISNamo1. (271 aa) |
| | Nmlp_3653 | ISH14-type transposase ISNamo9. (211 aa) |
| | Nmlp_3639 | ISH14-type transposase ISNamo7. (211 aa) |
| | Nmlp_3611 | IS1341-type transposase ISNamo19. (419 aa) |
| | Nmlp_3610 | IS200-type transposase ISNamo19; Gene is interrupted (frameshift,in-frame stop) and is truncated at the N-terminus; locus_tag: Nmlp_3609; product: ISH14-type transposase NmIRS15 (nonfunctional). (129 aa) |
| | dnaJ | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, [...] (385 aa) |
| | rfcC | Replication factor C small subunit. (341 aa) |
| | nthB | Endonuclease 3. (271 aa) |
| | polY1 | DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis. (400 aa) |
| | phr2 | Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. (466 aa) |
| | Nmlp_3219 | uracil-DNA glycosylase superfamily protein. (195 aa) |
| | phr4 | Cryptochrome/photolyase-related protein. (509 aa) |
| | Nmlp_3206 | ISH14-type transposase ISNamo8. (206 aa) |
| | Nmlp_3194 | Probable DEAD/DEAH box helicase. (932 aa) |
| | rpa1 | Replication protein A. (423 aa) |
| | Nmlp_3148 | IS1341-type transposase ISNamo20. (439 aa) |
| | rfcB | Replication factor C large subunit; Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA; Belongs to the activator 1 small subunits family. RfcL subfamily. (492 aa) |
| | radB | DNA repair and recombination protein RadB; Involved in DNA repair and in homologous recombination. May regulate the cleavage reactions of the branch-structured DNA. Has a very weak ATPase activity that is not stimulated by DNA. Binds DNA but does not promote DNA strands exchange. (236 aa) |
| | nthA | Endonuclease 3; DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N-glycosidic bond, leaving an AP (apurinic/apyrimidinic) site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'- phosphate. (227 aa) |
| | Nmlp_2986 | Uncharacterized protein. (168 aa) |
| | Nmlp_2974 | Probable phosphoesterase. (230 aa) |
| | Nmlp_2929 | XerC/D-like integrase. (336 aa) |
| | Nmlp_2921 | Uncharacterized protein. (588 aa) |
| | dna2 | ATP-dependent DNA helicase Dna2. (883 aa) |
| | ligB | DNA ligase (ATP); DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. (552 aa) |
| | Nmlp_2857 | DNA N-glycosylase. (306 aa) |
| | Nmlp_2780 | IS1341-type transposase ISNamo26. (423 aa) |
| | Nmlp_2698 | XerC/D-like integrase. (345 aa) |
| | phr3 | Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. (526 aa) |
| | Nmlp_2666 | IS1341-type transposase ISNamo17. (411 aa) |
