STRINGSTRING
Nmlp_1019 Nmlp_1019 Nmlp_1031 Nmlp_1031 polX polX ligA ligA radA radA Nmlp_1149 Nmlp_1149 rpa3 rpa3 uvrC uvrC nreA nreA rpa2 rpa2 hef hef Nmlp_1402 Nmlp_1402 ashA ashA rpl32e rpl32e nfi nfi rad50 rad50 mre11 mre11 lhr1 lhr1 mutS5b mutS5b lhr2 lhr2 uvrD uvrD mutS1a mutS1a Nmlp_1923 Nmlp_1923 Nmlp_1924 Nmlp_1924 fen1 fen1 mutY mutY Nmlp_2492 Nmlp_2492 polY2 polY2 Nmlp_2616 Nmlp_2616 phr3 phr3 Nmlp_2857 Nmlp_2857 ligB ligB Nmlp_2974 Nmlp_2974 nthA nthA radB radB rpa1 rpa1 Nmlp_3194 Nmlp_3194 phr4 phr4 Nmlp_3219 Nmlp_3219 phr2 phr2 polY1 polY1 nthB nthB rfcC rfcC apn1 apn1 hjc hjc udg udg uvrB uvrB mutS1b mutS1b mutL mutL ogt ogt hel308a hel308a uvrA uvrA mutS5a mutS5a
Nodes:
Network nodes represent proteins
splice isoforms or post-translational modifications are collapsed, i.e. each node represents all the proteins produced by a single, protein-coding gene locus.
Node Color
colored nodes:
query proteins and first shell of interactors
white nodes:
second shell of interactors
Node Content
empty nodes:
proteins of unknown 3D structure
filled nodes:
a 3D structure is known or predicted
Edges:
Edges represent protein-protein associations
associations are meant to be specific and meaningful, i.e. proteins jointly contribute to a shared function; this does not necessarily mean they are physically binding to each other.
Known Interactions
from curated databases
experimentally determined
Predicted Interactions
gene neighborhood
gene fusions
gene co-occurrence
Others
textmining
co-expression
protein homology
Your Input:
Nmlp_1019HAD superfamily hydrolase. (289 aa)
Nmlp_1031DEAD/DEAH box helicase. (794 aa)
polXDNA-directed DNA polymerase X. (580 aa)
ligADNA ligase (NAD); DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double- stranded DNA using NAD as a coenzyme and as the energy source for the reaction. It is essential for DNA replication and repair of damaged DNA. (690 aa)
radADNA repair and recombination protein RadA; Involved in DNA repair and in homologous recombination. Binds and assemble on single-stranded DNA to form a nucleoprotein filament. Hydrolyzes ATP in a ssDNA-dependent manner and promotes DNA strand exchange between homologous DNA molecules. (345 aa)
Nmlp_1149Uncharacterized protein. (729 aa)
rpa3Replication protein A. (309 aa)
uvrCUvrABC system protein C; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible for the 3' incision and the C-terminal half is responsible for the 5' incision. (576 aa)
nreADNA repair protein NreA; Involved in DNA damage repair. (426 aa)
rpa2Replication protein A. (471 aa)
hefATP-dependent RNA helicase/nuclease Hef; Product: Kef-type transport system (probable substrate potassium) (nonfunctional). (835 aa)
Nmlp_1402HAD superfamily hydrolase. (208 aa)
ashAArchaea-specific helicase AshA. (675 aa)
rpl32e50S ribosomal protein L32e; Belongs to the eukaryotic ribosomal protein eL32 family. (239 aa)
nfiEndonuclease 5; DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the intact lesion on the nicked DNA. (245 aa)
rad50DNA double-strand break repair ATPase Rad50; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Rad50 controls the balance between DNA end bridging and DNA resection via ATP-dependent structural rearrangements of the Rad50/Mre11 complex. Belongs to the SMC family. RAD50 subfamily. (887 aa)
mre11DNA double-strand break repair protein Mre11; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Mre11 binds to DSB ends and has both double-stranded 3'-5' exonuclease activity and single-stranded endonuclease activity; Belongs to the MRE11/RAD32 family. (465 aa)
lhr1ATP-dependent DNA helicase. (950 aa)
mutS5bDNA mismatch repair protein MutS. (582 aa)
lhr2ATP-dependent DNA helicase; Gene has a frameshift; locus_tag: Nmlp_1797; product: uncharacterized protein (nonfunctional); conceptual translation after in silico reconstruction: MVPDSPPSTLRDRLPAETESNALIYGFVGGVVGIVLSAVPLST LLGGIVAGYGGRFEDGLKAGAVAGVVTFVPFVVLFFLLLAFLGFGGAPIALGVFGAVA LVFVAAYTVGLAVLGGYLGIYIRHEL. (946 aa)
uvrDRepair helicase UvrD. (614 aa)
mutS1aDNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. It is possible that it carries out the mismatch recognition step. This protein has a weak ATPase activity. (861 aa)
Nmlp_1923YfiH family protein. (263 aa)
Nmlp_1924HAD superfamily hydrolase. (217 aa)
fen1Flap endonuclease Fen1; Structure-specific nuclease with 5'-flap endonuclease and 5'- 3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. Binds the unpaired 3'-DNA end and kinks the DNA to facilitate 5' cleavage specificity. Cleaves one nucleotide into the double-stranded DNA from the junction in flap DNA, leaving a nick for ligation. Also involved in the base excision repair (BER) pathway [...] (327 aa)
mutYA/G-specific adenine glycosylase. (339 aa)
Nmlp_2492KaiC domain protein. (485 aa)
polY2DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis. (421 aa)
Nmlp_2616Probable DEAD/DEAH box helicase. (817 aa)
phr3Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. (526 aa)
Nmlp_2857DNA N-glycosylase. (306 aa)
ligBDNA ligase (ATP); DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. (552 aa)
Nmlp_2974Probable phosphoesterase. (230 aa)
nthAEndonuclease 3; DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N-glycosidic bond, leaving an AP (apurinic/apyrimidinic) site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'- phosphate. (227 aa)
radBDNA repair and recombination protein RadB; Involved in DNA repair and in homologous recombination. May regulate the cleavage reactions of the branch-structured DNA. Has a very weak ATPase activity that is not stimulated by DNA. Binds DNA but does not promote DNA strands exchange. (236 aa)
rpa1Replication protein A. (423 aa)
Nmlp_3194Probable DEAD/DEAH box helicase. (932 aa)
phr4Cryptochrome/photolyase-related protein. (509 aa)
Nmlp_3219uracil-DNA glycosylase superfamily protein. (195 aa)
phr2Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. (466 aa)
polY1DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis. (400 aa)
nthBEndonuclease 3. (271 aa)
rfcCReplication factor C small subunit. (341 aa)
apn1Endonuclease 4; Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5'-ends that are base-free deoxyribose 5-phosphate residues. It preferentially attacks modified AP sites created by bleomycin and neocarzinostatin. (277 aa)
hjcHolliday junction resolvase Hjc; A structure-specific endonuclease that resolves Holliday junction (HJ) intermediates during genetic recombination. Cleaves 4-way DNA junctions introducing paired nicks in opposing strands, leaving a 5'-terminal phosphate and a 3'-terminal hydroxyl group that are ligated to produce recombinant products; Belongs to the Holliday junction resolvase Hjc family. (173 aa)
udguracil-DNA glycosylase. (193 aa)
uvrBUvrABC system protein B; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnormalities. Upon binding of the UvrA(2)B(2) complex to a putative damaged site, the DNA wraps around one UvrB monomer. DNA wrap is dependent on ATP binding by UvrB and probably causes local melting of the DNA helix, facilitating insertion of UvrB beta-hairpin between the DNA strands. Then UvrB probes one DNA strand for the presence of a lesion. If a lesion is found the UvrA subunits dissociate and [...] (683 aa)
mutS1bDNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. (922 aa)
mutLDNA mismatch repair protein MutL; This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a 'molecular matchmaker', a protein that promotes the formation of a stable complex between two or more DNA-binding proteins in an ATP-dependent manner without itself being part of a final effector complex. (700 aa)
ogtProbable methylated-DNA--protein-cysteine methyltransferase. (153 aa)
hel308aATP-dependent DNA helicase Hel308; DNA-dependent ATPase and 3'-5' DNA helicase that may be involved in repair of stalled replication forks. (769 aa)
uvrAUvrABC system protein A; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrA is an ATPase and a DNA-binding protein. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnormalities. When the presence of a lesion has been verified by UvrB, the UvrA molecules dissociate. (977 aa)
mutS5aDNA mismatch repair protein MutS; Has ATPase and non-specific DNA-binding activities. Belongs to the DNA mismatch repair MutS family. Archaeal Muts2 subfamily. (678 aa)
Your Current Organism:
Natronomonas moolapensis
NCBI taxonomy Id: 268739
Other names: N. moolapensis 8.8.11, Natronomonas moolapensis 8.8.11, Natronomonas moolapensis DSM 18674, Natronomonas moolapensis JCM 14361, Natronomonas moolapensis str. 8.8.11, Natronomonas moolapensis strain 8.8.11, haloarchaeon CSW8.8.11
Server load: low (24%) [HD]
STRING is a Core Data Resource as designated by Global Biodata Coalition and ELIXIR.