Your Input: | |
| | Nmlp_3756 | Probable oxidoreductase (aldo-keto reductase family protein). (272 aa) |
| | adh | Alcohol dehydrogenase. (355 aa) |
| | Nmlp_3801 | Flavin-containing amine-oxidoreductase. (348 aa) |
| | Nmlp_3802 | Probable oxidoreductase (short-chain dehydrogenase family). (245 aa) |
| | Nmlp_3813 | DUF420 family protein. (200 aa) |
| | hom | Homoserine dehydrogenase. (314 aa) |
| | Nmlp_3837 | Probable sugar dehydrogenase (homolog to aldose sugar dehydrogenase). (445 aa) |
| | proC | Pyrroline-5-carboxylate reductase; Catalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline. (258 aa) |
| | proA | Gamma-glutamyl phosphate reductase; Catalyzes the NADPH-dependent reduction of L-glutamate 5- phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclization to form 1-pyrroline-5-carboxylate. Belongs to the gamma-glutamyl phosphate reductase family. (455 aa) |
| | grx1 | Glutaredoxin. (81 aa) |
| | ferC | Ferredoxin (4Fe-4S). (80 aa) |
| | mdh | Malate dehydrogenase; Belongs to the LDH/MDH superfamily. (303 aa) |
| | hcp3 | Halocyanin. (215 aa) |
| | trxA3 | Thioredoxin. (138 aa) |
| | Nmlp_2824 | Probable oxidoreductase (short-chain dehydrogenase family); Belongs to the short-chain dehydrogenases/reductases (SDR) family. (252 aa) |
| | gdhA | Glutamate dehydrogenase; Gene has frameshifts; locus_tag: Nmlp_2832; product: homolog to citrate lyase beta subunit (nonfunctional); conceptual translation after in silico reconstruction: MARRSVLFSPGDRPELMRNAPHTGADTVVFDLEDAVVPEAKAA AREAVAGVLGDPAFEPDCEVCVRLNPDPETAALDAEAIAANDPRLDSIAVPEAESAGD VRAIHELVAARGHDRPVIALCESAAGVLGAEDIAAADPVEAVAFGVVDIGATRTGAEI AHARQHDVLAPGAAGVDAVDTLVTDIGAEDHLKSEAGVARQLGYDGKMAIHPAQVEII NEAFTPPPENVEWAKCVLTAADAAEQKGRGVARVDDEMVDAPLISRAETVPERHEAAE RD; Belongs to the Glu/Leu/Phe/Val dehydrogenases family. (419 aa) |
| | bdhA2 | 3-hydroxybutyrate dehydrogenase. (289 aa) |
| | grx3 | Glutaredoxin. (89 aa) |
| | Nmlp_2879 | Peroxiredoxin domain protein. (158 aa) |
| | Nmlp_2972 | Amine oxidase domain protein. (417 aa) |
| | dapB | 4-hydroxy-tetrahydrodipicolinate reductase; Catalyzes the conversion of 4-hydroxy-tetrahydrodipicolinate (HTPA) to tetrahydrodipicolinate; Belongs to the DapB family. (246 aa) |
| | icd | Isocitrate dehydrogenase (NADP). (418 aa) |
| | gltB | Glutamate synthase large subunit. (1507 aa) |
| | aglM | UDP-glucose 6-dehydrogenase AglM. (431 aa) |
| | cyc2 | Cytochrome P450. (463 aa) |
| | Nmlp_3025 | Probable oxidoreductase (short-chain dehydrogenase family). (231 aa) |
| | crtD | Carotenoid 3,4-desaturase. (492 aa) |
| | Nmlp_3046 | Probable oxidoreductase (aldo-keto reductase family protein). (276 aa) |
| | Nmlp_3048 | FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase). (450 aa) |
| | Nmlp_3050 | FAD-dependent oxidoreductase (GlcD/DLD_GlcF/GlpC domain fusion protein). (1004 aa) |
| | Nmlp_3081 | Flavin-dependent pyridine nucleotide oxidoreductase (homolog to coenzyme A disulfide reductase). (469 aa) |
| | folD | Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase; Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10- methenyltetrahydrofolate to 10-formyltetrahydrofolate. (297 aa) |
| | Nmlp_3097 | Homolog to ornithine cyclodeaminase. (332 aa) |
| | korB2 | Oxoglutarate--ferredoxin oxidoreductase beta subunit. (289 aa) |
| | trxB1 | Thioredoxin-disulfide reductase. (346 aa) |
| | gldA | Glycerol-1-phosphate dehydrogenase (NAD(P)); Catalyzes the NAD(P)H-dependent reduction of dihydroxyacetonephosphate (DHAP or glycerone phosphate) to glycerol 1- phosphate (G1P). The G1P thus generated is used as the glycerophosphate backbone of phospholipids in the cellular membranes of Archaea. Belongs to the glycerol-1-phosphate dehydrogenase family. (352 aa) |
| | hbd | 3-hydroxyacyl-CoA dehydrogenase. (287 aa) |
| | acd3 | acyl-CoA dehydrogenase. (373 aa) |
| | maeB2 | Malate dehydrogenase (oxaloacetate-decarboxylating). (752 aa) |
| | ctaA | Heme A synthase. (278 aa) |
| | ilvC | Ketol-acid reductoisomerase; Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yield (R)-2,3-dihydroxy-isovalerate. In the isomerase reaction, S2AL is rearranged via a Mg-dependent methyl migration to produce 3-hydroxy-3-methyl-2-ketobutyrate (HMKB). In the reductase reaction, this 2-ketoacid undergoes a metal-dependent reduction by NADPH to yield (R)-2,3-dihydroxy-isovalerate. (332 aa) |
| | leuB | 3-isopropylmalate dehydrogenase. (326 aa) |
| | dpsA2 | ferritin/Dps domain protein. (148 aa) |
| | hcp1 | Halocyanin. (179 aa) |
| | qor3 | NADPH:quinone reductase. (337 aa) |
| | Nmlp_3242 | Probable oxidoreductase (short-chain dehydrogenase family); Belongs to the short-chain dehydrogenases/reductases (SDR) family. (240 aa) |
| | sod | Superoxide dismutase (Mn); Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Belongs to the iron/manganese superoxide dismutase family. (201 aa) |
| | porA | Pyruvate--ferredoxin oxidoreductase alpha subunit. (628 aa) |
| | Nmlp_3266 | Oxidoreductase (homolog to zinc-containing alcohol dehydrogenase). (350 aa) |
| | sirC | Precorrin-2 oxidase / ferrochelatase. (215 aa) |
| | hemA | glutamyl-tRNA reductase; Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA). (454 aa) |
| | guaB1 | Inosine-5'-monophosphate dehydrogenase; Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Belongs to the IMPDH/GMPR family. (492 aa) |
| | Nmlp_3299 | Putative AhpD family alkylhydroperoxidase. (190 aa) |
| | katG | Catalase-peroxidase; Bifunctional enzyme with both catalase and broad-spectrum peroxidase activity; Belongs to the peroxidase family. Peroxidase/catalase subfamily. (715 aa) |
| | fadA4 | Enoyl-CoA hydratase; Gene has frameshifts and lacks a central region; locus_tag: Nmlp_3329; product: IS1341-type transposase NmIRS28 (nonfunctional); Belongs to the enoyl-CoA hydratase/isomerase family. (255 aa) |
| | Nmlp_3353 | Flavin reductase domain protein. (200 aa) |
| | sdhA2 | Succinate dehydrogenase subunit A; Deleted EC_number 1.3.99.1. (596 aa) |
| | dadA | Homolog to D-aspartate oxidase. (361 aa) |
| | Nmlp_3375 | Molybdopterin-binding domain protein. (499 aa) |
| | nuoA | NADH dehydrogenase-like complex subunit A. (134 aa) |
| | nuoB | NADH dehydrogenase-like complex subunit B; Belongs to the complex I 20 kDa subunit family. (229 aa) |
| | nuoCD | NADH dehydrogenase-like complex subunit CD. (559 aa) |
| | nuoH | NADH dehydrogenase-like complex subunit H. (358 aa) |
| | nuoI1 | NADH dehydrogenase-like complex subunit I. (153 aa) |
| | nuoJ1 | Gene: nuoI2; product: NADH dehydrogenase-like complex subunit I (nonfunctional). (92 aa) |
| | nuoK | NADH dehydrogenase-like complex subunit K. (104 aa) |
| | nuoL | NADH dehydrogenase-like complex subunit L. (674 aa) |
| | nuoM | NADH dehydrogenase-like complex subunit M. (516 aa) |
| | nuoN | NADH dehydrogenase-like complex subunit N. (493 aa) |
| | Nmlp_3431 | Probable oxidoreductase (short-chain dehydrogenase family). (254 aa) |
| | coxA | Cox-type terminal oxidase subunit I; Belongs to the heme-copper respiratory oxidase family. (605 aa) |
| | coxC | Cox-type terminal oxidase subunit III. (288 aa) |
| | coxB | Cox-type terminal oxidase subunit II. (250 aa) |
| | ctaB | Protoheme IX geranylgeranyltransferase; Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group. (459 aa) |
| | Nmlp_3445 | phytanoyl-CoA dioxygenase domain protein. (257 aa) |
| | Nmlp_3448 | Probable anaerobic dehydrogenase membrane anchor subunit. (445 aa) |
| | dpd | Putative dihydropyrimidine dehydrogenase. (259 aa) |
| | asd | Aspartate-semialdehyde dehydrogenase. (344 aa) |
| | Nmlp_3488 | FAD-dependent oxidoreductase. (215 aa) |
| | korA | Oxoglutarate--ferredoxin oxidoreductase alpha subunit. (587 aa) |
| | korB1 | Oxoglutarate--ferredoxin oxidoreductase beta subunit. (289 aa) |
| | Nmlp_3504 | FAD-dependent oxidoreductase. (381 aa) |
| | Nmlp_3548 | GMC family oxidoreductase. (532 aa) |
| | ala | Alanine dehydrogenase; Catalyzes the NAD(+)-dependent oxidative deamination of L- alanine to pyruvate, and the reverse reaction, the reductive amination of pyruvate; Belongs to the ornithine cyclodeaminase/mu-crystallin family. Archaeal alanine dehydrogenase subfamily. (331 aa) |
| | crtI2 | Phytoene dehydrogenase (phytoene desaturase). (518 aa) |
| | brp | Beta-carotene 15,15'-dioxygenase Brp; Catalyzes the cleavage of beta-carotene at its central double bond (15,15') to yield two molecules of all-trans-retinal. Belongs to the Brp/Blh beta-carotene diooxygenase family. (346 aa) |
| | Nmlp_3583 | Amine oxidase (copper-containing); Belongs to the copper/topaquinone oxidase family. (649 aa) |
| | mrpD4 | Mrp-type sodium/proton antiporter system subunit D4. (495 aa) |
| | Nmlp_3608 | Probable FAD-dependent oxidoreductase. (401 aa) |
| | pucL1 | Uricase; Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin. (307 aa) |
| | coxM | Molybdopterin-containing oxidoreductase medium subunit. (288 aa) |
| | coxL | Molybdopterin-containing oxidoreductase large subunit. (791 aa) |
| | coxS | Molybdopterin-containing oxidoreductase small subunit. (171 aa) |
| | glpC | Glycerol-3-phosphate dehydrogenase subunit C. (460 aa) |
| | glpB | Glycerol-3-phosphate dehydrogenase subunit B. (424 aa) |
| | glpA1 | Glycerol-3-phosphate dehydrogenase subunit A; Belongs to the FAD-dependent glycerol-3-phosphate dehydrogenase family. (576 aa) |
| | aor2 | Aldehyde ferredoxin oxidoreductase. (555 aa) |
| | aor1 | Aldehyde ferredoxin oxidoreductase; Product: probable DNA-binding protein (nonfunctional). (647 aa) |
| | fadA3 | enoyl-CoA hydratase. (254 aa) |
| | trxA7 | Thioredoxin. (231 aa) |
| | korB3 | Oxoglutarate--ferredoxin oxidoreductase beta subunit. (287 aa) |
| | ferB2 | Ferredoxin (3Fe-4S)(4Fe-4S), zinc-containing; Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. (112 aa) |
| | Nmlp_3724 | DUF393 family protein. (122 aa) |
| | Nmlp_3781 | Probable ferredoxin (4Fe-4S). (78 aa) |
| | npdG | F420H2:NADP oxidoreductase. (222 aa) |
| | pyrD | Dihydroorotate dehydrogenase (quinone); Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor; Belongs to the dihydroorotate dehydrogenase family. Type 2 subfamily. (349 aa) |
| | hcp4 | Halocyanin. (240 aa) |
| | msrB | Peptide methionine sulfoxide reductase MsrB (R-form specific). (131 aa) |
| | msrA1 | Peptide methionine sulfoxide reductase MsrA (S-form specific); Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. (182 aa) |
| | azf | Glucose-6-phosphate 1-dehydrogenase (NAD); Catalyzes the NAD-dependent oxidation of glucose 6-phosphate to 6-phosphogluconolactone; Belongs to the NAD(P)-dependent epimerase/dehydratase family. (255 aa) |
| | maeB1 | Malate dehydrogenase (oxaloacetate-decarboxylating). (752 aa) |
| | Nmlp_1127 | Lactate 2-monooxygenase. (397 aa) |
| | mer | Probable 5,10-methylenetetrahydrofolate reductase; Catalyzes the oxidation of methyl-H(4)MPT to methylene- H(4)MPT. (329 aa) |
| | aroE | Shikimate dehydrogenase; Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshikimate (DHSA) to yield shikimate (SA). (264 aa) |
| | hemQ | Heme-binding protein HemQ. (618 aa) |
| | etfB | Electron transfer flavoprotein beta subunit. (264 aa) |
| | etfA | Electron transfer flavoprotein alpha subunit. (322 aa) |
| | aroB | 3-dehydroquinate synthase, type II; Catalyzes the oxidative deamination and cyclization of 2- amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid (ADH) to yield 3- dehydroquinate (DHQ), which is fed into the canonical shikimic pathway of aromatic amino acid biosynthesis; Belongs to the archaeal-type DHQ synthase family. (388 aa) |
| | oxdhA1 | 2-oxo-3-methylvalerate dehydrogenase E1 component alpha subunit. (373 aa) |
| | Nmlp_1226 | Probable oxidoreductase (short-chain dehydrogenase family). (262 aa) |
| | trxA1 | Thioredoxin. (88 aa) |
| | argC | N-acetyl-gamma-glutamyl-phosphate reductase; Involved in both the arginine and lysine biosynthetic pathways; Belongs to the NAGSA dehydrogenase family. Type 1 subfamily. LysY sub-subfamily. (347 aa) |
| | Nmlp_1253 | FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase). (361 aa) |
| | blh | Beta-carotene 15,15'-dioxygenase Blh; Catalyzes the cleavage of beta-carotene at its central double bond (15,15') to yield two molecules of all-trans-retinal. Belongs to the Brp/Blh beta-carotene diooxygenase family. (363 aa) |
| | Nmlp_1321 | Oxidoreductase (homolog to thioredoxin-disulfide reductase). (196 aa) |
| | Nmlp_1328 | Oxidoreductase (homolog to zinc-containing alcohol dehydrogenase / threonine 3-dehydrogenase). (333 aa) |
| | Nmlp_1330 | Probable oxidoreductase (aldo-keto reductase family protein). (673 aa) |
| | phaB | 3-oxoacyl-CoA reductase (NADP). (246 aa) |
| | gdh | Glucose 1-dehydrogenase; Catalyzes the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate via gluconolactone. Can utilize both NAD(+) and NADP(+) as electron acceptor. Is involved in the degradation of glucose through a modified Entner-Doudoroff pathway. (353 aa) |
| | aldH2 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. (478 aa) |
| | bdbC | Disulfide bond formation protein. (135 aa) |
| | gndA | 6-phosphogluconate dehydrogenase (NAD-dependent, decarboxylating); Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NAD to NADH. (299 aa) |
| | serA1 | D-3-phosphoglycerate dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. (526 aa) |
| | mrpD3 | Mrp-type sodium/proton antiporter system subunit D3. (530 aa) |
| | mrpD2 | Mrp-type sodium/proton antiporter system subunit D2. (597 aa) |
| | qor1 | NADPH:quinone reductase. (351 aa) |
| | Nmlp_1478 | YqjG-type gamma-glutamylcysteinyl-hydroquinone reductase. (317 aa) |
| | msrA2 | Peptide methionine sulfoxide reductase MsrA (S-form specific). (210 aa) |
| | gap | Glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) (phosphorylating). (338 aa) |
| | Nmlp_1515 | Probable oxidoreductase (Short-chain dehydrogenase family); Gene is interrupted (frameshift,insert) and is truncated at the N-terminus; product: IS1341-type transposase NmIRS65 (nonfunctional); locus_tag: Nmlp_1514A; Belongs to the short-chain dehydrogenases/reductases (SDR) family. (240 aa) |
| | Nmlp_1522 | Iron-sulfur protein (4Fe-4S). (734 aa) |
| | trxB2 | Thioredoxin-disulfide reductase. (348 aa) |
| | Nmlp_1529 | Oxidoreductase (homolog to thioredoxin-disulfide reductase). (263 aa) |
| | folA2 | Dihydrofolate reductase. (160 aa) |
| | Nmlp_1561 | Probable beta-carotene 15,15'-monooxygenase. (469 aa) |
| | panE | 2-dehydropantoate 2-reductase; Catalyzes the NADPH-dependent reduction of ketopantoate into pantoic acid. (298 aa) |
| | aor3 | Aldehyde ferredoxin oxidoreductase. (559 aa) |
| | Nmlp_1664 | Probable oxidoreductase (short-chain dehydrogenase family); Belongs to the short-chain dehydrogenases/reductases (SDR) family. (275 aa) |
| | Nmlp_1675 | Probable oxidoreductase (Aldo-keto reductase family protein); Product: thioredoxin domain protein (nonfunctional). (352 aa) |
| | acd1 | acyl-CoA dehydrogenase. (380 aa) |
| | aldH3 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. (508 aa) |
| | trxA4 | Thioredoxin; Product: UspA domain protein (nonfunctional). (113 aa) |
| | bdhA1 | 3-hydroxybutyrate dehydrogenase. (287 aa) |
| | lpdA2 | Dihydrolipoyl dehydrogenase. (453 aa) |
| | Nmlp_1848 | Probable oxidoreductase (short-chain dehydrogenase family). (239 aa) |
| | glpA2 | Glycerol-3-phosphate dehydrogenase subunit A; Belongs to the FAD-dependent glycerol-3-phosphate dehydrogenase family. (409 aa) |
| | Nmlp_1856 | Probable oxidoreductase (homolog to saccharopine dehydrogenase). (422 aa) |
| | hcp2 | Halocyanin. (138 aa) |
| | Nmlp_1868 | HEAT-PBS family protein. (449 aa) |
| | Nmlp_1876 | Amine oxidase domain protein. (442 aa) |
| | Nmlp_1879 | Flavin-dependent pyridine nucleotide oxidoreductase. (427 aa) |
| | Nmlp_1892 | NamA family oxidoreductase. (357 aa) |
| | Nmlp_1962 | DUF420 family protein. (187 aa) |
| | sdhC | Succinate dehydrogenase subunit C; Deleted EC_number 1.3.99.1. (130 aa) |
| | sdhD | Succinate dehydrogenase subunit D; Deleted EC_number 1.3.99.1. (121 aa) |
| | sdhB | Succinate dehydrogenase subunit B; Deleted EC_number 1.3.99.1. (285 aa) |
| | sdhA1 | Succinate dehydrogenase subunit A; Deleted EC_number 1.3.99.1. (611 aa) |
| | Nmlp_1996 | Peroxiredoxin. (159 aa) |
| | Nmlp_2007 | YuiH family molybdopterin-binding domain protein. (195 aa) |
| | Nmlp_2055 | Oxidoreductase (homolog to zinc-containing alcohol dehydrogenase). (338 aa) |
| | Nmlp_2058 | Peroxiredoxin. (159 aa) |
| | Nmlp_2063 | Luciferase-type oxidoreductase. (307 aa) |
| | Nmlp_2069 | FAD dependent oxidoreductase. (472 aa) |
| | nirA2 | Probable sulfite/nitrite reductase (ferredoxin). (584 aa) |
| | mmsA | Methylmalonate-semialdehyde dehydrogenase. (493 aa) |
| | Nmlp_2089 | SCO1/SenC/PrrC family protein. (227 aa) |
| | ddh | D-2-hydroxyacid dehydrogenase (NADP); Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. (307 aa) |
| | Nmlp_2130 | Peroxiredoxin domain protein. (171 aa) |
| | grx2 | Glutaredoxin. (103 aa) |
| | gabD | Succinate-semialdehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. (534 aa) |
| | serA3 | Probable D-2-hydroxyacid dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. (321 aa) |
| | arfC | 2,5-diamino-6-(Ribosylamino)-4(3H)-pyrimidinone 5'-phosphate reductase; Gene has a frameshift and is truncated at the N-terminus; locus_tag: Nmlp_2211; product: poly(3-hydroxybutyrate) depolymerase (nonfunctional). (219 aa) |
| | serA2 | Probable D-2-hydroxyacid dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. (312 aa) |
| | hisD | Histidinol dehydrogenase; Catalyzes the sequential NAD-dependent oxidations of L- histidinol to L-histidinaldehyde and then to L-histidine. (422 aa) |
| | guaB2 | Inosine-5'-monophosphate dehydrogenase. (344 aa) |
| | tyrA | Prephenate dehydrogenase. (242 aa) |
| | acd2 | acyl-CoA dehydrogenase. (384 aa) |
| | lpdA1 | Dihydrolipoyl dehydrogenase. (474 aa) |
| | cyc1 | Cytochrome P450. (446 aa) |
| | oxdhA2 | Probable 2-oxoacid dehydrogenase E1 component alpha subunit. (372 aa) |
| | Nmlp_2307 | Homolog to NAD(P)H dehydrogenase (quinone). (193 aa) |
| | trxA2 | Thioredoxin. (129 aa) |
| | Nmlp_2334 | FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase). (457 aa) |
| | Nmlp_2335 | Probable oxidoreductase (aldo-keto reductase family protein). (274 aa) |
| | qor2 | NADPH:quinone reductase. (321 aa) |
| | Nmlp_2378 | Probable oxidoreductase (aldo-keto reductase family protein). (324 aa) |
| | hmgA | hydroxymethylglutaryl-CoA reductase (NADPH); Belongs to the HMG-CoA reductase family. (402 aa) |
| | nadB | L-aspartate oxidase. (529 aa) |
| | fabG2 | 3-oxoacyl-[acyl-carrier-protein] reductase. (256 aa) |
| | Nmlp_2429 | FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase). (456 aa) |
| | Nmlp_2434 | Redoxin domain protein. (188 aa) |
| | ndh | Probable NADH dehydrogenase. (388 aa) |
| | cbaB | Ba3-type terminal oxidase subunit II. (166 aa) |
| | cbaA | Ba3-type terminal oxidase subunit I. (585 aa) |
| | Nmlp_2521 | Probable FAD-dependent oxidoreductase. (401 aa) |
| | dpsA3 | Ferritin / Dps domain protein. (219 aa) |
| | Nmlp_2570 | ARM/HEAT repeat protein. (399 aa) |
| | folA1 | Dihydrofolate reductase; Belongs to the dihydrofolate reductase family. (167 aa) |
| | Nmlp_2680 | FMO domain protein; Gene has an in-frame stop codon and is truncated at both termini; product: ISH9-type transposase NmIRS4 (nonfunctional); locus_tag: Nmlp_2679B. (612 aa) |
| | Nmlp_2691 | HEAT-PBS family taxis protein. (439 aa) |
| | fdhA | Formate dehydrogenase alpha subunit. (675 aa) |
| | dpsA1 | Ferritin DpsA; Belongs to the Dps family. (181 aa) |
| | ferB1 | Ferredoxin (3Fe-4S)(4Fe-4S), zinc-containing. (109 aa) |
| | grx4 | Glutaredoxin. (135 aa) |
| | Nmlp_2793 | Rhodanese domain protein / beta-lactamase domain protein. (386 aa) |
