Your Input: | |
| | Nmlp_2646 | Homolog to restriction system mrr N-terminal region. (71 aa) |
| | rps19 | 30S ribosomal protein S19; Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA. (140 aa) |
| | rpl2 | 50S ribosomal protein L2; One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity; this is somewhat controversial. Makes several contacts with the 16S rRNA in the 70S ribosome. Belongs to the universal ribosomal protein uL2 family. (243 aa) |
| | rpl23 | 50S ribosomal protein L23; Binds to 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Belongs to the universal ribosomal protein uL23 family. (82 aa) |
| | rpl4 | 50S ribosomal protein L4; Forms part of the polypeptide exit tunnel. (248 aa) |
| | rpl3 | 50S ribosomal protein L3; One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit; Belongs to the universal ribosomal protein uL3 family. (336 aa) |
| | Nmlp_1621 | Integrase family protein. (400 aa) |
| | Nmlp_1635 | ISH9-type transposase ISNamo2; Gene has been targetted by a transposon; locus_tag: Nmlp_1634; product: sensor box histidine kinase (nonfunctional); conceptual translation after in silico reconstruction: MASEHERIDSHAVLDSLPDALFVVDRQRTISYANQRLCNVLNI SRIDLLDEPLAFLDQFVYEGFENLVSAIDEVLSGRQDDLRTEIETTLPEAAPVQQHIT VDARVTAADGNGISGALVVLRNVEEYHERQAQPRHEAQRFRTMFERHSAPMLLIDPDS GRIENANRSAVDFYGYDADRLYGMPIERINCHSPEEVSRKHKCAHRGDQNCFEFEHRL ASGETRAVEVHSSPIEIEGRTLLFSIVHDVTDRKESRRELRVFREAVAQAGHSVIITD VDGAIEYVNPAFEEVTGYDGDEIAGETPEVLNSGRRDPQFYEQLWETIRSGNVWEAEL VNQTKSGELYYAEHTIAPIVGDDGEITNFVAVQKDITERKLKQKRLSELH [...] (276 aa) |
| | Nmlp_1642 | DUF790 family protein. (450 aa) |
| | Nmlp_1646 | XerC/D-like integrase. (337 aa) |
| | Nmlp_1647 | ISH14-type transposase ISNamo13. (226 aa) |
| | Nmlp_1649 | PHP domain protein. (225 aa) |
| | gatC | aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl- tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp- tRNA(Asn) or phospho-Glu-tRNA(Gln); Belongs to the GatC family. (89 aa) |
| | gatA | aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu- tRNA(Gln). (426 aa) |
| | nfi | Endonuclease 5; DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the intact lesion on the nicked DNA. (245 aa) |
| | smc | Chromosome segregation protein Smc; Required for chromosome condensation and partitioning. Belongs to the SMC family. (1192 aa) |
| | hisS | histidine--tRNA ligase; Belongs to the class-II aminoacyl-tRNA synthetase family. (432 aa) |
| | Nmlp_1673 | ISH14-type transposase ISNamo7. (211 aa) |
| | Nmlp_1678 | ISH14-type transposase ISNamo8. (211 aa) |
| | Nmlp_1689 | ISH14-type transposase ISNamo11. (211 aa) |
| | polB | DNA-directed DNA polymerase B (intein-containing). (1376 aa) |
| | rad50 | DNA double-strand break repair ATPase Rad50; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Rad50 controls the balance between DNA end bridging and DNA resection via ATP-dependent structural rearrangements of the Rad50/Mre11 complex. Belongs to the SMC family. RAD50 subfamily. (887 aa) |
| | mre11 | DNA double-strand break repair protein Mre11; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Mre11 binds to DSB ends and has both double-stranded 3'-5' exonuclease activity and single-stranded endonuclease activity; Belongs to the MRE11/RAD32 family. (465 aa) |
| | pan2 | Proteasome-activating nucleotidase; ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C- termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase- [...] (404 aa) |
| | cna | tRNA/rRNA cytosine-C5-methylase; Belongs to the class I-like SAM-binding methyltransferase superfamily. RsmB/NOP family. (303 aa) |
| | rps10b | 30S ribosomal protein S10b; Involved in the binding of tRNA to the ribosomes. Belongs to the universal ribosomal protein uS10 family. (108 aa) |
| | Nmlp_1726 | ISH14-type transposase ISNamo9. (211 aa) |
| | Nmlp_1728 | ISH11-type transposase ISNamo4. (330 aa) |
| | Nmlp_1738 | Homolog to phage integrase. (336 aa) |
| | Nmlp_1751 | IS1341-type transposase ISNamo23. (411 aa) |
| | priS | DNA primase small subunit; Catalytic subunit of DNA primase, an RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. The small subunit contains the primase catalytic core and has DNA synthesis activity on its own. Binding to the large subunit stabilizes and modulates the activity, increasing the rate of DNA synthesis while decreasing the length of the DNA fragments, and conferring RNA synthesis capability. The DNA polymerase activity may enable DNA primase to also catalyze primer extension after primer synthesis. [...] (393 aa) |
| | Tif2Bd | eIF-2B domain protein; Belongs to the eIF-2B alpha/beta/delta subunits family. (284 aa) |
| | lhr1 | ATP-dependent DNA helicase. (950 aa) |
| | mutS5b | DNA mismatch repair protein MutS. (582 aa) |
| | Nmlp_1793 | DUF814 domain protein. (703 aa) |
| | pelA | mRNA surveillance protein pelota; May function in recognizing stalled ribosomes, interact with stem-loop structures in stalled mRNA molecules, and effect endonucleolytic cleavage of the mRNA. May play a role in the release non-functional ribosomes and degradation of damaged mRNAs. Has endoribonuclease activity. (355 aa) |
| | lhr2 | ATP-dependent DNA helicase; Gene has a frameshift; locus_tag: Nmlp_1797; product: uncharacterized protein (nonfunctional); conceptual translation after in silico reconstruction: MVPDSPPSTLRDRLPAETESNALIYGFVGGVVGIVLSAVPLST LLGGIVAGYGGRFEDGLKAGAVAGVVTFVPFVVLFFLLLAFLGFGGAPIALGVFGAVA LVFVAAYTVGLAVLGGYLGIYIRHEL. (946 aa) |
| | uvrD | Repair helicase UvrD. (614 aa) |
| | Nmlp_1809 | ISH14-type transposase ISNamo8. (211 aa) |
| | rpl37e | 50S ribosomal protein L37e; Binds to the 23S rRNA; Belongs to the eukaryotic ribosomal protein eL37 family. (57 aa) |
| | rpl15e | 50S ribosomal protein L15e; Belongs to the eukaryotic ribosomal protein eL15 family. (196 aa) |
| | mutS1a | DNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. It is possible that it carries out the mismatch recognition step. This protein has a weak ATPase activity. (861 aa) |
| | nucS | Endonuclease NucS; Cleaves both 3' and 5' ssDNA extremities of branched DNA structures; Belongs to the NucS endonuclease family. (248 aa) |
| | Nmlp_1842 | Product: thioredoxin domain protein (nonfunctional). (211 aa) |
| | Nmlp_1847 | ISH14-type transposase ISNamo9. (211 aa) |
| | Nmlp_1853 | IS1341-type transposase ISNamo21; Gene has been targetted by a transposon; locus_tag: Nmlp_1855; conceptual translation after in silico reconstruction: MSTDNSDDTTEHHAHEHRDVGGPGYPTPAAMRTESGREQTAYV MAPRVGMQNDGPGFVGVVDLDPASDTYSELIDTVEMPNKGDELHHFGWNACSSSCHAE GLSRQYLIVPGQRSSRIHVIDAEEPRDPEIVTVIEPEELFEYDLSAPHTVHCVPGGKI VISMLGDADGELPGGFLQLDQEDFSIDGRWEADRGAMEMNYDYWYQPRYDVLISSEWA APNTYYPGFDLDDVEAGNYGDSIHIWSWDDREHVQTLEFGDAGRIPLEVRMSHNPEET QGYVGAALSSNIIRFYESTDGAWEWDVVIDEDPREHEDWDMPVPPLIIDILLSLDDQY LFFSNWLHGDVRMYDVSDAANPRLVDRVWAGGLFGDRQEIQDKEIRGAPQMLQLSRDG TRLYWTTSLFSSWDNQFFPEMAEEGSLMFKADVFPDEGRLDL [...] (459 aa) |
| | thrS | threonine--tRNA ligase; Belongs to the class-II aminoacyl-tRNA synthetase family. (642 aa) |
| | gth1 | Probable glycosyltransferase, type 1. (366 aa) |
| | gtl3 | Probable glycosyltransferase, type 2. (255 aa) |
| | Nmlp_1886 | DUF2298 family protein. (754 aa) |
| | rpl43e | 50S ribosomal protein L43e. (86 aa) |
| | pth | peptidyl-tRNA hydrolase. (112 aa) |
| | Nmlp_1905 | IS1341-type transposase ISNamo23. (411 aa) |
| | Nmlp_1910 | Gene has been targetted by a transposon; locus_tag: Nmlp_1911; product: IS1341-type transposase ISNamo20 (nonfunctional); conceptual translation after in silico reconstruction: MLEIHRTHRAKILNHSQVEDPLDRHGWSASKLWNVANYHSRQK WDDTGEIPDHSDLKDELKGHSKYKGLHSQSSQRVLEELAEAFNSWYEKRKSDNRANPP GYRKKNYYDDHGNRVHEEHPRSTVTWKQNGIKHDTKNNRVRLSKGSNHKEHPKAWEYI LVEYETRPGVTVENLQQVRAVYDKAKRRWELHLVCKDEIETPTAPGNETAGIDLGICN FAAVAYSTEQADLYPGNRLKQDGYYFPKEIAKCDDSGGKEAPRLHAKWSERRTHFFHS LSKHIVQRCIERGVGRINIGKLAGVREDDNGEAKNWGRHGNLDLHGWAFDRFTSILEY KAEVEGVEVVEVSERDTSKTCCVCGREDESQRVERGLYVCEPCDAVFNADVNGAENIR LELKQSNSESAPDLGGD [...] (211 aa) |
| | Nmlp_1923 | YfiH family protein. (263 aa) |
| | Nmlp_1924 | HAD superfamily hydrolase. (217 aa) |
| | Nmlp_1933 | ISH9-type transposase ISNamo1. (271 aa) |
| | trm56 | tRNA (cytidine(56)-2'-O)-methyltransferase; Specifically catalyzes the AdoMet-dependent 2'-O-ribose methylation of cytidine at position 56 in tRNAs; Belongs to the aTrm56 family. (215 aa) |
| | rpl11 | 50S ribosomal protein L11; Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors; Belongs to the universal ribosomal protein uL11 family. (163 aa) |
| | drg | GTP-binding protein Drg. (371 aa) |
| | Nmlp_1976 | RimK family protein. (448 aa) |
| | fen1 | Flap endonuclease Fen1; Structure-specific nuclease with 5'-flap endonuclease and 5'- 3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. Binds the unpaired 3'-DNA end and kinks the DNA to facilitate 5' cleavage specificity. Cleaves one nucleotide into the double-stranded DNA from the junction in flap DNA, leaving a nick for ligation. Also involved in the base excision repair (BER) pathway [...] (327 aa) |
| | gatE | glutamyl-tRNA(Gln) amidotransferase subunit E; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu- tRNA(Gln). The GatDE system is specific for glutamate and does not act on aspartate. (617 aa) |
| | tef5A | Translation elongation factor aEF-5A; Functions by promoting the formation of the first peptide bond; Belongs to the eIF-5A family. (124 aa) |
| | topA | DNA topoisomerase 1; Releases the supercoiling and torsional tension of DNA, which is introduced during the DNA replication and transcription, by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA- (5'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 3'-OH DNA strand. The free DNA strand then undergoes passage around the unbroken strand, thus removing DNA supe [...] (849 aa) |
| | gatB | aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl- tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp- tRNA(Asn) or phospho-Glu-tRNA(Gln); Belongs to the GatB/GatE family. GatB subfamily. (496 aa) |
| | serS | serine--tRNA ligase; Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L- seryl-tRNA(Sec), which will be further converted into selenocysteinyl- tRNA(Sec). (458 aa) |
| | Nmlp_2138 | PaaI family protein. (146 aa) |
| | Nmlp_2142 | Uncharacterized protein. (296 aa) |
| | rps15 | 30S ribosomal protein S15. (154 aa) |
| | rps1e | 30S ribosomal protein S1e; Belongs to the eukaryotic ribosomal protein eS1 family. (208 aa) |
| | Nmlp_2167 | Integrase family protein. (368 aa) |
| | zim | CTAG modification methylase. (367 aa) |
| | Nmlp_2213 | tRNA (cytidine/uridine-2'-O-)-methyltransferase. (258 aa) |
| | Nmlp_2296 | Homolog to translation elongation factor aEF-1 alpha subunit. (541 aa) |
| | tif1A2 | Translation initiation factor aIF-1A; Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits. (94 aa) |
| | Nmlp_2306 | DHH/RecJ family phosphoesterase. (733 aa) |
| | mutY | A/G-specific adenine glycosylase. (339 aa) |
| | nosD2 | ABC-type transport system periplasmic substrate-binding protein (probable substrate copper). (703 aa) |
| | nosD1 | ABC-type transport system periplasmic substrate-binding protein (probable substrate copper). (629 aa) |
| | Nmlp_2321 | TRAM domain protein. (151 aa) |
| | dnaG | DNA primase DnaG; RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. (514 aa) |
| | rpl42e | 50S ribosomal protein L42e; Binds to the 23S rRNA. (93 aa) |
| | rps27e | 30S ribosomal protein S27e. (57 aa) |
| | tif2a | Translation initiation factor aIF-2 alpha subunit. (266 aa) |
| | aglB | Dolichyl-monophosphooligosaccharide--protein glycotransferase AglB. (957 aa) |
| | Nmlp_2364 | DUF368 family protein. (314 aa) |
| | psmA | Proteasome alpha subunit; Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. (249 aa) |
| | top6A | DNA topoisomerase 6 subunit A; Relaxes both positive and negative superturns and exhibits a strong decatenase activity; Belongs to the TOP6A family. (370 aa) |
| | gyrB | DNA gyrase subunit B; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state. Negative supercoiling favors strand separation, and DNA replication, transcription, recombination and repair, all of which involve strand separation. Also able to catalyze the interconversion of other topological isomers of dsDNA rings, including catenanes and knotted rings. Type II topoisomerases break and join 2 DNA strands simultaneously in an ATP-dependent manner. (639 aa) |
| | gyrA | DNA gyrase subunit A; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state. Negative supercoiling favors strand separation, and DNA replication, transcription, recombination and repair, all of which involve strand separation. Also able to catalyze the interconversion of other topological isomers of dsDNA rings, including catenanes and knotted rings. Type II topoisomerases break and join 2 DNA strands simultaneously in an ATP-dependent manner. (848 aa) |
| | tif2b1 | Translation initiation factor aIF-2 beta subunit. (135 aa) |
| | orc3 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. (418 aa) |
| | Nmlp_2491 | IS1341-type transposase ISNamo20. (439 aa) |
| | Nmlp_2492 | KaiC domain protein. (485 aa) |
| | Nmlp_2495 | Integrase family protein; Product: ABC-type transport system permease protein (nonfunctional). (428 aa) |
| | polY2 | DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis. (421 aa) |
| | Nmlp_2509 | ISH9-type transposase NmIRS1. (287 aa) |
| | orc4 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. (315 aa) |
| | Nmlp_2525 | UPF0066 family protein; Gene has a frameshift; locus_tag: Nmlp_2524; product: ISH9-type transposase NmIRS2 (nonfunctional); conceptual translation after in silico reconstruction: MQALPESRLLRFVEQAYHLARRAVARYSSKFSKRRYTLHQHIV LLYLKIRKNTTYRTLLDELIEMPRIRSAIGLEEIPSPSTLCKAFNRLDMAVWRGLLNL SVTLLPTNGVVGIDASGFDRSHASKHYTKRTKLTIQRLKVTLLVDTKANAILNLHVTT TRKHDSQIAPSLIKRNTDEVTILLGDKGYDDQKVRALAREDGVRPVIKYREFSSLNKA WNARLDADLYGQRSQNETVNSSLKRKYGFVRSRHWWKQFRELVVGCLTHNIDTSL. (163 aa) |
| | Nmlp_2565 | Uncharacterized protein. (96 aa) |
| | Nmlp_2572 | IS1341-type transposase ISNamo24; Gene has been targetted by a transposon; locus_tag: Nmlp_2571; product: small CPxCG-related zinc finger protein (nonfunctional); conceptual translation after in silico reconstruction: MSTTDLSTLGDCPRCSASVTSIDVLIEYKIDGQPAVYAVHAEC PGCQAVIKPA. (434 aa) |
| | Nmlp_2579 | ISH14-type transposase ISNamo8. (211 aa) |
| | Nmlp_2584 | Homolog to 5-methylcytosine restriction system protein McrC. (400 aa) |
| | Nmlp_2586 | ISH14-type transposase ISNamo7. (211 aa) |
| | Nmlp_2590 | ISH14-type transposase ISNamo13. (226 aa) |
| | Nmlp_2597 | Integrase family protein. (424 aa) |
| | Nmlp_2605 | ISH9-type transposase ISNamo1. (271 aa) |
| | Nmlp_2611 | ISH14-type transposase ISNamo13. (226 aa) |
| | Nmlp_2616 | Probable DEAD/DEAH box helicase. (817 aa) |
| | rpl22 | 50S ribosomal protein L22; The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome. (154 aa) |
| | Nmlp_2651 | IS1341-type transposase ISNamo25. (410 aa) |
| | Nmlp_2656 | ISH14-type transposase ISNamo8. (211 aa) |
| | orc5 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. (405 aa) |
| | Nmlp_2665 | IS200-type transposase ISNamo17. (129 aa) |
| | Nmlp_2666 | IS1341-type transposase ISNamo17. (411 aa) |
| | phr3 | Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. (526 aa) |
| | cheR | Protein-glutamate O-methyltransferase CheR. (271 aa) |
| | Nmlp_2698 | XerC/D-like integrase. (345 aa) |
| | rpl8e | 50S ribosomal protein L8e; Multifunctional RNA-binding protein that recognizes the K- turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs. (120 aa) |
| | rps28e | 30S ribosomal protein S28e; Belongs to the eukaryotic ribosomal protein eS28 family. (74 aa) |
| | rpl24e | 50S ribosomal protein L24e; Binds to the 23S rRNA; Belongs to the eukaryotic ribosomal protein eL24 family. (123 aa) |
| | prmC | Probable S-adenosylmethionine-dependent methyltransferase PrmC. (191 aa) |
| | ksgA | Ribosome biogenesis protein KsgA, 16S rRNA-methylating; Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits. Belongs to the class I-like SAM-binding methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. RsmA subfamily. (273 aa) |
| | rpl21e | 50S ribosomal protein L21e; Belongs to the eukaryotic ribosomal protein eL21 family. (97 aa) |
| | tef1b | Translation elongation factor aEF-1 beta subunit; Promotes the exchange of GDP for GTP in EF-1-alpha/GDP, thus allowing the regeneration of EF-1-alpha/GTP that could then be used to form the ternary complex EF-1-alpha/GTP/AAtRNA. (88 aa) |
| | gltS | glutamate--tRNA(Glu/Gln) ligase; Catalyzes the attachment of glutamate to tRNA(Glu) in a two- step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu). (571 aa) |
| | rnj | Ribonuclease J; An RNase that has 5'-3' exonuclease activity. May be involved in RNA degradation; Belongs to the metallo-beta-lactamase superfamily. RNA- metabolizing metallo-beta-lactamase-like family. Archaeal RNase J subfamily. (446 aa) |
| | rps2 | 30S ribosomal protein S2; Belongs to the universal ribosomal protein uS2 family. (268 aa) |
| | rps9 | 30S ribosomal protein S9; Belongs to the universal ribosomal protein uS9 family. (132 aa) |
| | rpl13 | 50S ribosomal protein L13; This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages of 50S assembly. (149 aa) |
| | rpl18e | 50S ribosomal protein L18e; Belongs to the eukaryotic ribosomal protein eL18 family. (117 aa) |
| | rps11 | 30S ribosomal protein S11; Located on the platform of the 30S subunit. Belongs to the universal ribosomal protein uS11 family. (127 aa) |
| | rps4 | 30S ribosomal protein S4; One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit. (174 aa) |
| | rps13 | 30S ribosomal protein S13; Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement; Belongs to the universal ribosomal protein uS13 family. (171 aa) |
| | rps6e | 30S ribosomal protein S6e; Belongs to the eukaryotic ribosomal protein eS6 family. (129 aa) |
| | Nmlp_2780 | IS1341-type transposase ISNamo26. (423 aa) |
| | tyrS | tyrosine--tRNA ligase. (345 aa) |
| | Nmlp_2857 | DNA N-glycosylase. (306 aa) |
| | ligB | DNA ligase (ATP); DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. (552 aa) |
| | dna2 | ATP-dependent DNA helicase Dna2. (883 aa) |
| | Nmlp_2921 | Uncharacterized protein. (588 aa) |
| | Nmlp_2929 | XerC/D-like integrase. (336 aa) |
| | Nmlp_2974 | Probable phosphoesterase. (230 aa) |
| | proS | proline--tRNA ligase; Catalyzes the attachment of proline to tRNA(Pro) in a two- step reaction: proline is first activated by ATP to form Pro-AMP and then transferred to the acceptor end of tRNA(Pro). (482 aa) |
| | Nmlp_2986 | Uncharacterized protein. (168 aa) |
| | Tif2Ba | NUDIX family hydrolase / eIF-2B domain protein; Belongs to the eIF-2B alpha/beta/delta subunits family. (425 aa) |
| | trmY | tRNA (pseudouridine(54)-N(1))-methyltransferase; Specifically catalyzes the N1-methylation of pseudouridine at position 54 (Psi54) in tRNAs; Belongs to the methyltransferase superfamily. TrmY family. (196 aa) |
| | nthA | Endonuclease 3; DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N-glycosidic bond, leaving an AP (apurinic/apyrimidinic) site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'- phosphate. (227 aa) |
| | radB | DNA repair and recombination protein RadB; Involved in DNA repair and in homologous recombination. May regulate the cleavage reactions of the branch-structured DNA. Has a very weak ATPase activity that is not stimulated by DNA. Binds DNA but does not promote DNA strands exchange. (236 aa) |
| | rps8e | 30S ribosomal protein S8e. (123 aa) |
| | rpl1 | 50S ribosomal protein L1; Binds directly to 23S rRNA. Probably involved in E site tRNA release. (212 aa) |
| | rpl10 | 50S ribosomal protein L10; Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors. Belongs to the universal ribosomal protein uL10 family. (352 aa) |
| | rpl12 | 50S ribosomal protein L12; Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors. Belongs to the eukaryotic ribosomal protein P1/P2 family. (112 aa) |
| | cysS | cysteine--tRNA ligase. (497 aa) |
| | rpc34 | Probable transcription factor (homolog to RNA polymerase III subunit RPC34). (118 aa) |
| | ansB | Asparaginase/glutaminase family protein. (316 aa) |
| | trm5 | tRNA (guanine(37)-N(1))-methyltransferase. (330 aa) |
| | Nmlp_3090 | DUF2298 family protein. (789 aa) |
| | rfcB | Replication factor C large subunit; Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA; Belongs to the activator 1 small subunits family. RfcL subfamily. (492 aa) |
| | Nmlp_3148 | IS1341-type transposase ISNamo20. (439 aa) |
| | rpa1 | Replication protein A. (423 aa) |
| | Nmlp_3194 | Probable DEAD/DEAH box helicase. (932 aa) |
| | Nmlp_3206 | ISH14-type transposase ISNamo8. (206 aa) |
| | phr4 | Cryptochrome/photolyase-related protein. (509 aa) |
| | Nmlp_3219 | uracil-DNA glycosylase superfamily protein. (195 aa) |
| | rpl40e | 50S ribosomal protein L40e; Belongs to the eukaryotic ribosomal protein eL40 family. (49 aa) |
| | metS | methionine--tRNA ligase; Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation. (705 aa) |
| | phr2 | Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. (466 aa) |
| | polY1 | DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis. (400 aa) |
| | rnhB | Ribonuclease H, type 2; Endonuclease that specifically degrades the RNA of RNA-DNA hybrids; Belongs to the RNase HII family. (210 aa) |
| | Nmlp_3321 | DUF790 family protein. (500 aa) |
| | nthB | Endonuclease 3. (271 aa) |
| | Nmlp_3332 | HD family hydrolase. (233 aa) |
| | rps17e | 30S ribosomal protein S17e; Belongs to the eukaryotic ribosomal protein eS17 family. (63 aa) |
| | aspS | aspartate--tRNA(Asp/Asn) ligase; Aspartyl-tRNA synthetase with relaxed tRNA specificity since it is able to aspartylate not only its cognate tRNA(Asp) but also tRNA(Asn). Reaction proceeds in two steps: L-aspartate is first activated by ATP to form Asp-AMP and then transferred to the acceptor end of tRNA(Asp/Asn). (434 aa) |
| | rfcC | Replication factor C small subunit. (341 aa) |
| | trmG10 | tRNA (guanine(10),N(2))-dimethyltransferase. (318 aa) |
| | alaS | alanine--tRNA ligase; Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged Ser-tRNA(Ala) and Gly-tRNA(Ala) via its editing domain. (928 aa) |
| | trpS | tryptophan--tRNA ligase; Catalyzes the attachment of tryptophan to tRNA(Trp). (536 aa) |
| | ileS | isoleucine--tRNA ligase; Catalyzes the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pretransfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'posttransfer' editing and involves deacylation of mischarged Val-tRNA(Ile). Belongs to the class-I aminoacyl-tRNA synthetase family. IleS type 2 subfamily. (1070 aa) |
| | dnaJ | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, [...] (385 aa) |
| | Nmlp_3610 | IS200-type transposase ISNamo19; Gene is interrupted (frameshift,in-frame stop) and is truncated at the N-terminus; locus_tag: Nmlp_3609; product: ISH14-type transposase NmIRS15 (nonfunctional). (129 aa) |
| | Nmlp_3611 | IS1341-type transposase ISNamo19. (419 aa) |
| | Nmlp_3639 | ISH14-type transposase ISNamo7. (211 aa) |
| | Nmlp_3653 | ISH14-type transposase ISNamo9. (211 aa) |
| | Nmlp_3676 | ISH9-type transposase ISNamo1. (271 aa) |
| | Nmlp_3686 | Integrase family protein / sensor/bat box HTH-10 family transcription regulator. (837 aa) |
| | apn1 | Endonuclease 4; Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5'-ends that are base-free deoxyribose 5-phosphate residues. It preferentially attacks modified AP sites created by bleomycin and neocarzinostatin. (277 aa) |
| | trmI | tRNA (adenine-N(1))-methyltransferase TrmI. (243 aa) |
| | tfs1 | Transcription elongation factor TFS; Belongs to the archaeal rpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family. (108 aa) |
| | hjc | Holliday junction resolvase Hjc; A structure-specific endonuclease that resolves Holliday junction (HJ) intermediates during genetic recombination. Cleaves 4-way DNA junctions introducing paired nicks in opposing strands, leaving a 5'-terminal phosphate and a 3'-terminal hydroxyl group that are ligated to produce recombinant products; Belongs to the Holliday junction resolvase Hjc family. (173 aa) |
| | Nmlp_3732 | ABCE1 family ribosome recycling factor. (612 aa) |
| | valS | valine--tRNA ligase; Catalyzes the attachment of valine to tRNA(Val). As ValRS can inadvertently accommodate and process structurally similar amino acids such as threonine, to avoid such errors, it has a 'posttransfer' editing activity that hydrolyzes mischarged Thr-tRNA(Val) in a tRNA- dependent manner; Belongs to the class-I aminoacyl-tRNA synthetase family. ValS type 2 subfamily. (887 aa) |
| | tif2b2 | Translation initiation factor aIF-2 beta subunit. (203 aa) |
| | cbiT | cobalt-precorrin-6B C15-methyltransferase (decarboxylating); Catalyzes the methylation of C-15 in cobalt-precorrin-6B followed by the decarboxylation of C-12 to form cobalt-precorrin-7. (179 aa) |
| | tif5B | Translation initiation factor aIF-5B (bacterial-type IF2); Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2. (603 aa) |
| | Nmlp_3809 | arNOG05511 family protein (AAA-type ATPase core domain protein); Belongs to the AAA ATPase family. (436 aa) |
| | udg | uracil-DNA glycosylase. (193 aa) |
| | rps10a | 30S ribosomal protein S10a; Involved in the binding of tRNA to the ribosomes. Belongs to the universal ribosomal protein uS10 family. (102 aa) |
| | tef1a | Translation elongation factor aEF-1 alpha subunit; This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis. Belongs to the TRAFAC class translation factor GTPase superfamily. Classic translation factor GTPase family. EF-Tu/EF-1A subfamily. (421 aa) |
| | tef2 | Translation elongation factor aEF-2; Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome; Belongs to the TRAFAC class translation factor GTPase superfamily. Classic translation factor GTPase family. EF-G/EF [...] (729 aa) |
| | rps7 | 30S ribosomal protein S7; One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center; Belongs to the universal ribosomal protein uS7 family. (203 aa) |
| | rps12 | 30S ribosomal protein S12; With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits. Belongs to the universal ribosomal protein uS12 family. (142 aa) |
| | uvrB | UvrABC system protein B; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnormalities. Upon binding of the UvrA(2)B(2) complex to a putative damaged site, the DNA wraps around one UvrB monomer. DNA wrap is dependent on ATP binding by UvrB and probably causes local melting of the DNA helix, facilitating insertion of UvrB beta-hairpin between the DNA strands. Then UvrB probes one DNA strand for the presence of a lesion. If a lesion is found the UvrA subunits dissociate and [...] (683 aa) |
| | rlmE | 23S rRNA (uridine-2'-O-) methyltransferase; Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit. (252 aa) |
| | gatD | glutamyl-tRNA(Gln) amidotransferase subunit D; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu- tRNA(Gln). The GatDE system is specific for glutamate and does not act on aspartate. (414 aa) |
| | mutS1b | DNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. (922 aa) |
| | mutL | DNA mismatch repair protein MutL; This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a 'molecular matchmaker', a protein that promotes the formation of a stable complex between two or more DNA-binding proteins in an ATP-dependent manner without itself being part of a final effector complex. (700 aa) |
| | pheT | phenylalanine--tRNA ligase beta subunit. (634 aa) |
| | pheS | phenylalanine--tRNA ligase alpha subunit. (504 aa) |
| | ogt | Probable methylated-DNA--protein-cysteine methyltransferase. (153 aa) |
| | hel308a | ATP-dependent DNA helicase Hel308; DNA-dependent ATPase and 3'-5' DNA helicase that may be involved in repair of stalled replication forks. (769 aa) |
| | uvrA | UvrABC system protein A; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrA is an ATPase and a DNA-binding protein. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnormalities. When the presence of a lesion has been verified by UvrB, the UvrA molecules dissociate. (977 aa) |
| | polD1 | DNA-directed DNA polymerase D exonuclease subunit DP1; Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3' to 5' direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase; Belongs to the DNA polymerase delta/II small subunit family. (642 aa) |
| | polD2 | DNA-directed DNA polymerase D large subunit (intein-containing); Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase. (1486 aa) |
| | Nmlp_3946 | Integrase family protein. (287 aa) |
| | mutS5a | DNA mismatch repair protein MutS; Has ATPase and non-specific DNA-binding activities. Belongs to the DNA mismatch repair MutS family. Archaeal Muts2 subfamily. (678 aa) |
| | orc2 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. (374 aa) |
| | orc1 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. (519 aa) |
| | Nmlp_1012 | IS1341-type transposase ISNamo20. (439 aa) |
| | Nmlp_1019 | HAD superfamily hydrolase. (289 aa) |
| | Nmlp_1028 | Nonhistone chromosomal protein. (103 aa) |
| | Nmlp_1031 | DEAD/DEAH box helicase. (794 aa) |
| | cbiE | Cobalt-precorrin-7 C5-methyltransferase. (247 aa) |
| | polX | DNA-directed DNA polymerase X. (580 aa) |
| | rfcA | Replication factor C small subunit; Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA; Belongs to the activator 1 small subunits family. RfcS subfamily. (324 aa) |
| | ligA | DNA ligase (NAD); DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double- stranded DNA using NAD as a coenzyme and as the energy source for the reaction. It is essential for DNA replication and repair of damaged DNA. (690 aa) |
| | radA | DNA repair and recombination protein RadA; Involved in DNA repair and in homologous recombination. Binds and assemble on single-stranded DNA to form a nucleoprotein filament. Hydrolyzes ATP in a ssDNA-dependent manner and promotes DNA strand exchange between homologous DNA molecules. (345 aa) |
| | Nmlp_1096 | IS1341-type transposase ISNamo20. (439 aa) |
| | Nmlp_1103 | TRAM domain protein. (129 aa) |
| | trm1 | tRNA (guanine(26)-N(2))-dimethyltransferase; Dimethylates a single guanine residue at position 26 of a number of tRNAs using S-adenosyl-L-methionine as donor of the methyl groups; Belongs to the class I-like SAM-binding methyltransferase superfamily. Trm1 family. (366 aa) |
| | Nmlp_1149 | Uncharacterized protein. (729 aa) |
| | spt5 | Transcription elongation factor Spt5; Stimulates transcription elongation; Belongs to the archaeal Spt5 family. (146 aa) |
| | Nmlp_1156 | PHP domain protein. (251 aa) |
| | lysS | lysine--tRNA ligase; Belongs to the class-I aminoacyl-tRNA synthetase family. (546 aa) |
| | rps19e | 30S ribosomal protein S19e; May be involved in maturation of the 30S ribosomal subunit. Belongs to the eukaryotic ribosomal protein eS19 family. (151 aa) |
| | taw2 | tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase; S-adenosyl-L-methionine-dependent transferase that acts as a component of the wyosine derivatives biosynthesis pathway. Catalyzes the transfer of the alpha-amino-alpha-carboxypropyl (acp) group from S- adenosyl-L-methionine to 4-demethylwyosine (imG-14), forming 7- aminocarboxypropyl-demethylwyosine (wybutosine-86) at position 37 of tRNA(Phe). (342 aa) |
| | pan1 | Proteasome-activating nucleotidase; ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C- termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase- [...] (405 aa) |
| | aglD | Glycosyltransferase AglD. (608 aa) |
| | pcn | DNA polymerase sliding clamp; Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication. (247 aa) |
| | priL | DNA primase large subunit; Regulatory subunit of DNA primase, an RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. Stabilizes and modulates the activity of the small subunit, increasing the rate of DNA synthesis, and conferring RNA synthesis capability. The DNA polymerase activity may enable DNA primase to also catalyze primer extension after primer synthesis. May also play a role in DNA repair. (360 aa) |
| | rpa3 | Replication protein A. (309 aa) |
| | leuS | leucine--tRNA ligase; Belongs to the class-I aminoacyl-tRNA synthetase family. (900 aa) |
| | uvrC | UvrABC system protein C; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible for the 3' incision and the C-terminal half is responsible for the 5' incision. (576 aa) |
| | Nmlp_1276 | Probable restriction/modification enzyme. (1194 aa) |
| | Nmlp_1285 | IS1341-type transposase ISNamo19. (419 aa) |
| | Nmlp_1286 | IS200-type transposase ISNamo19. (130 aa) |
| | rpl16 | 50S ribosomal protein L16; Belongs to the universal ribosomal protein uL16 family. (177 aa) |
| | atpH | A-type ATP synthase subunit H. (112 aa) |
| | tif6 | Translation initiation factor aIF-6; Binds to the 50S ribosomal subunit and prevents its association with the 30S ribosomal subunit to form the 70S initiation complex. (221 aa) |
| | rpl31e | 50S ribosomal protein L31e; Belongs to the ribosomal protein L31e family. (90 aa) |
| | rpl39e | 50S ribosomal protein L39e; Belongs to the eukaryotic ribosomal protein eL39 family. (50 aa) |
| | Nmlp_1336 | PHP domain protein. (256 aa) |
| | nosD3 | ABC-type transport system periplasmic substrate-binding protein (probable substrate copper). (665 aa) |
| | Nmlp_1349 | Probable S-adenosylmethionine-dependent methyltransferase. (210 aa) |
| | nreA | DNA repair protein NreA; Involved in DNA damage repair. (426 aa) |
| | Nmlp_1360 | Probable amidase. (489 aa) |
| | argS | arginine--tRNA ligase; Belongs to the class-I aminoacyl-tRNA synthetase family. (580 aa) |
| | rpa2 | Replication protein A. (471 aa) |
| | glyS | glycine--tRNA ligase. (578 aa) |
| | hef | ATP-dependent RNA helicase/nuclease Hef; Product: Kef-type transport system (probable substrate potassium) (nonfunctional). (835 aa) |
| | Nmlp_1382 | PUA domain protein. (159 aa) |
| | Nmlp_1402 | HAD superfamily hydrolase. (208 aa) |
| | arf1 | Peptide chain release factor aRF-1; Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. (412 aa) |
| | tif1 | Translation initiation factor aIF-1 (SUI1 protein, bacterial-type IF3); Belongs to the SUI1 family. (97 aa) |
| | Nmlp_1437 | ISH14-type transposase ISNamo12. (211 aa) |
| | Nmlp_1438 | IS1341-type transposase ISNamo22; Product: nitroreductase family protein (nonfunctional); part of the region does not belong to this CDS as coordinates speficy only the outer boundaries; gene has been targetted by a transposon. (445 aa) |
| | rpl20e | 50S ribosomal protein L20e. (57 aa) |
| | ashA | Archaea-specific helicase AshA. (675 aa) |
| | pimT2 | protein-L-isoaspartate O-methyltransferase. (244 aa) |
| | pimT1 | protein-L-isoaspartate O-methyltransferase; Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. (240 aa) |
| | Nmlp_1500 | UCP015877 family protein. (216 aa) |
| | Nmlp_1510 | IS1341-type transposase ISNamo18. (411 aa) |
| | CCT61390.1 | IS200-type transposase ISNamo18. (127 aa) |
| | Nmlp_1512 | ISH14-type transposase ISNamo10. (211 aa) |
| | tif1A1 | Translation initiation factor aIF-1A; Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits. (97 aa) |
| | rps31e | 30S ribosomal protein S31e; Belongs to the eukaryotic ribosomal protein eS31 family. (44 aa) |
| | rps24e | 30S ribosomal protein S24e; Belongs to the eukaryotic ribosomal protein eS24 family. (103 aa) |
| | spt4 | Transcription elongation factor Spt4; Stimulates transcription elongation; Belongs to the archaeal Spt4 family. (65 aa) |
| | tif2c | Translation initiation factor aIF-2 gamma subunit; eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. Belongs to the TRAFAC class translation factor GTPase superfamily. Classic translation factor GTPase family. EIF2G subfamily. (409 aa) |
| | rpl15 | 50S ribosomal protein L15; Binds to the 23S rRNA; Belongs to the universal ribosomal protein uL15 family. (166 aa) |
| | rpl30 | 50S ribosomal protein L30. (154 aa) |
| | rps5 | 30S ribosomal protein S5; Belongs to the universal ribosomal protein uS5 family. (211 aa) |
| | rpl18 | 50S ribosomal protein L18; This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. (184 aa) |
| | rpl19e | 50S ribosomal protein L19e; Binds to the 23S rRNA; Belongs to the eukaryotic ribosomal protein eL19 family. (149 aa) |
| | rpl32e | 50S ribosomal protein L32e; Belongs to the eukaryotic ribosomal protein eL32 family. (239 aa) |
| | rpl6 | 50S ribosomal protein L6; This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center; Belongs to the universal ribosomal protein uL6 family. (177 aa) |
| | rps8 | 30S ribosomal protein S8; One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit; Belongs to the universal ribosomal protein uS8 family. (130 aa) |
| | rps14 | 30S ribosomal protein S14; Binds 16S rRNA, required for the assembly of 30S particles. (59 aa) |
| | rpl5 | 50S ribosomal protein L5; This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. May contact the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs. (180 aa) |
| | rps4e | 30S ribosomal protein S4e; Belongs to the eukaryotic ribosomal protein eS4 family. (269 aa) |
| | rpl24 | 50S ribosomal protein L24; Located at the polypeptide exit tunnel on the outside of the subunit. (120 aa) |
| | rpl14 | 50S ribosomal protein L14; Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome; Belongs to the universal ribosomal protein uL14 family. (132 aa) |
| | rps17 | 30S ribosomal protein S17; One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA. (114 aa) |
| | rpl29 | 50S ribosomal protein L29; Belongs to the universal ribosomal protein uL29 family. (69 aa) |
| | rps3 | 30S ribosomal protein S3; Binds the lower part of the 30S subunit head. Belongs to the universal ribosomal protein uS3 family. (301 aa) |
