STRINGSTRING
phr1 phr1 Nmlp_2509 Nmlp_2509 Nmlp_2578 Nmlp_2578 Nmlp_2581 Nmlp_2581 Nmlp_2584 Nmlp_2584 Nmlp_2605 Nmlp_2605 Nmlp_2665 Nmlp_2665 Nmlp_2673 Nmlp_2673 phr3 phr3 Nmlp_2857 Nmlp_2857 ligB ligB dna2 dna2 Nmlp_2914 Nmlp_2914 Nmlp_2921 Nmlp_2921 Nmlp_2927 Nmlp_2927 Nmlp_3005 Nmlp_3005 rad25c rad25c nthA nthA radB radB rfcB rfcB Nmlp_3219 Nmlp_3219 phr2 phr2 polY1 polY1 nthB nthB polY2 polY2 rad25a rad25a Nmlp_3610 Nmlp_3610 Nmlp_3676 Nmlp_3676 apn1 apn1 hjc hjc udg udg uvrB uvrB rad3b rad3b mutS1b mutS1b mutL mutL hel308a hel308a polD1 polD1 polD2 polD2 mutS5a mutS5a uvrC uvrC Nmlp_1276 Nmlp_1276 Nmlp_1277 Nmlp_1277 Nmlp_1286 Nmlp_1286 Nmlp_1336 Nmlp_1336 hef hef CCT61390.1 CCT61390.1 rad3a rad3a Nmlp_1635 Nmlp_1635 rad25b rad25b Nmlp_1649 Nmlp_1649 nfi nfi polB polB rad50 rad50 mre11 mre11 Nmlp_1728 Nmlp_1728 lhr1 lhr1 mutS5b mutS5b uvrD uvrD mutS1a mutS1a nucS nucS Nmlp_1933 Nmlp_1933 fen1 fen1 topA topA zim zim mutY mutY top6A top6A gyrB gyrB gyrA gyrA Nmlp_1031 Nmlp_1031 polX polX rfcA rfcA Nmlp_1085 Nmlp_1085 ligA ligA radA radA
Nodes:
Network nodes represent proteins
splice isoforms or post-translational modifications are collapsed, i.e. each node represents all the proteins produced by a single, protein-coding gene locus.
Node Color
colored nodes:
query proteins and first shell of interactors
white nodes:
second shell of interactors
Node Content
empty nodes:
proteins of unknown 3D structure
filled nodes:
a 3D structure is known or predicted
Edges:
Edges represent protein-protein associations
associations are meant to be specific and meaningful, i.e. proteins jointly contribute to a shared function; this does not necessarily mean they are physically binding to each other.
Known Interactions
from curated databases
experimentally determined
Predicted Interactions
gene neighborhood
gene fusions
gene co-occurrence
Others
textmining
co-expression
protein homology
Your Input:
phr1Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. (461 aa)
Nmlp_2509ISH9-type transposase NmIRS1. (287 aa)
Nmlp_2578Probable helicase. (829 aa)
Nmlp_2581UvrD/REP family helicase. (1272 aa)
Nmlp_2584Homolog to 5-methylcytosine restriction system protein McrC. (400 aa)
Nmlp_2605ISH9-type transposase ISNamo1. (271 aa)
Nmlp_2665IS200-type transposase ISNamo17. (129 aa)
Nmlp_2673Uncharacterized protein. (1158 aa)
phr3Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. (526 aa)
Nmlp_2857DNA N-glycosylase. (306 aa)
ligBDNA ligase (ATP); DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. (552 aa)
dna2ATP-dependent DNA helicase Dna2. (883 aa)
Nmlp_2914UvrD/REP family helicase. (1153 aa)
Nmlp_2921Uncharacterized protein. (588 aa)
Nmlp_2927ATP-dependent helicase. (584 aa)
Nmlp_3005arNOG05179 family protein (DUF87-related AAA-type ATPase). (615 aa)
rad25cDNA repair helicase Rad25. (632 aa)
nthAEndonuclease 3; DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N-glycosidic bond, leaving an AP (apurinic/apyrimidinic) site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'- phosphate. (227 aa)
radBDNA repair and recombination protein RadB; Involved in DNA repair and in homologous recombination. May regulate the cleavage reactions of the branch-structured DNA. Has a very weak ATPase activity that is not stimulated by DNA. Binds DNA but does not promote DNA strands exchange. (236 aa)
rfcBReplication factor C large subunit; Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA; Belongs to the activator 1 small subunits family. RfcL subfamily. (492 aa)
Nmlp_3219uracil-DNA glycosylase superfamily protein. (195 aa)
phr2Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. (466 aa)
polY1DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis. (400 aa)
nthBEndonuclease 3. (271 aa)
polY2DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis. (421 aa)
rad25aDNA repair helicase Rad25. (449 aa)
Nmlp_3610IS200-type transposase ISNamo19; Gene is interrupted (frameshift,in-frame stop) and is truncated at the N-terminus; locus_tag: Nmlp_3609; product: ISH14-type transposase NmIRS15 (nonfunctional). (129 aa)
Nmlp_3676ISH9-type transposase ISNamo1. (271 aa)
apn1Endonuclease 4; Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5'-ends that are base-free deoxyribose 5-phosphate residues. It preferentially attacks modified AP sites created by bleomycin and neocarzinostatin. (277 aa)
hjcHolliday junction resolvase Hjc; A structure-specific endonuclease that resolves Holliday junction (HJ) intermediates during genetic recombination. Cleaves 4-way DNA junctions introducing paired nicks in opposing strands, leaving a 5'-terminal phosphate and a 3'-terminal hydroxyl group that are ligated to produce recombinant products; Belongs to the Holliday junction resolvase Hjc family. (173 aa)
udguracil-DNA glycosylase. (193 aa)
uvrBUvrABC system protein B; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnormalities. Upon binding of the UvrA(2)B(2) complex to a putative damaged site, the DNA wraps around one UvrB monomer. DNA wrap is dependent on ATP binding by UvrB and probably causes local melting of the DNA helix, facilitating insertion of UvrB beta-hairpin between the DNA strands. Then UvrB probes one DNA strand for the presence of a lesion. If a lesion is found the UvrA subunits dissociate and [...] (683 aa)
rad3bDNA repair helicase Rad3. (722 aa)
mutS1bDNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. (922 aa)
mutLDNA mismatch repair protein MutL; This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a 'molecular matchmaker', a protein that promotes the formation of a stable complex between two or more DNA-binding proteins in an ATP-dependent manner without itself being part of a final effector complex. (700 aa)
hel308aATP-dependent DNA helicase Hel308; DNA-dependent ATPase and 3'-5' DNA helicase that may be involved in repair of stalled replication forks. (769 aa)
polD1DNA-directed DNA polymerase D exonuclease subunit DP1; Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3' to 5' direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase; Belongs to the DNA polymerase delta/II small subunit family. (642 aa)
polD2DNA-directed DNA polymerase D large subunit (intein-containing); Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase. (1486 aa)
mutS5aDNA mismatch repair protein MutS; Has ATPase and non-specific DNA-binding activities. Belongs to the DNA mismatch repair MutS family. Archaeal Muts2 subfamily. (678 aa)
uvrCUvrABC system protein C; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible for the 3' incision and the C-terminal half is responsible for the 5' incision. (576 aa)
Nmlp_1276Probable restriction/modification enzyme. (1194 aa)
Nmlp_1277Probable DEAD/DEAH box helicase. (1237 aa)
Nmlp_1286IS200-type transposase ISNamo19. (130 aa)
Nmlp_1336PHP domain protein. (256 aa)
hefATP-dependent RNA helicase/nuclease Hef; Product: Kef-type transport system (probable substrate potassium) (nonfunctional). (835 aa)
CCT61390.1IS200-type transposase ISNamo18. (127 aa)
rad3aDNA repair helicase Rad3. (811 aa)
Nmlp_1635ISH9-type transposase ISNamo2; Gene has been targetted by a transposon; locus_tag: Nmlp_1634; product: sensor box histidine kinase (nonfunctional); conceptual translation after in silico reconstruction: MASEHERIDSHAVLDSLPDALFVVDRQRTISYANQRLCNVLNI SRIDLLDEPLAFLDQFVYEGFENLVSAIDEVLSGRQDDLRTEIETTLPEAAPVQQHIT VDARVTAADGNGISGALVVLRNVEEYHERQAQPRHEAQRFRTMFERHSAPMLLIDPDS GRIENANRSAVDFYGYDADRLYGMPIERINCHSPEEVSRKHKCAHRGDQNCFEFEHRL ASGETRAVEVHSSPIEIEGRTLLFSIVHDVTDRKESRRELRVFREAVAQAGHSVIITD VDGAIEYVNPAFEEVTGYDGDEIAGETPEVLNSGRRDPQFYEQLWETIRSGNVWEAEL VNQTKSGELYYAEHTIAPIVGDDGEITNFVAVQKDITERKLKQKRLSELH [...] (276 aa)
rad25bDNA repair helicase Rad25. (469 aa)
Nmlp_1649PHP domain protein. (225 aa)
nfiEndonuclease 5; DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the intact lesion on the nicked DNA. (245 aa)
polBDNA-directed DNA polymerase B (intein-containing). (1376 aa)
rad50DNA double-strand break repair ATPase Rad50; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Rad50 controls the balance between DNA end bridging and DNA resection via ATP-dependent structural rearrangements of the Rad50/Mre11 complex. Belongs to the SMC family. RAD50 subfamily. (887 aa)
mre11DNA double-strand break repair protein Mre11; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Mre11 binds to DSB ends and has both double-stranded 3'-5' exonuclease activity and single-stranded endonuclease activity; Belongs to the MRE11/RAD32 family. (465 aa)
Nmlp_1728ISH11-type transposase ISNamo4. (330 aa)
lhr1ATP-dependent DNA helicase. (950 aa)
mutS5bDNA mismatch repair protein MutS. (582 aa)
uvrDRepair helicase UvrD. (614 aa)
mutS1aDNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. It is possible that it carries out the mismatch recognition step. This protein has a weak ATPase activity. (861 aa)
nucSEndonuclease NucS; Cleaves both 3' and 5' ssDNA extremities of branched DNA structures; Belongs to the NucS endonuclease family. (248 aa)
Nmlp_1933ISH9-type transposase ISNamo1. (271 aa)
fen1Flap endonuclease Fen1; Structure-specific nuclease with 5'-flap endonuclease and 5'- 3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. Binds the unpaired 3'-DNA end and kinks the DNA to facilitate 5' cleavage specificity. Cleaves one nucleotide into the double-stranded DNA from the junction in flap DNA, leaving a nick for ligation. Also involved in the base excision repair (BER) pathway [...] (327 aa)
topADNA topoisomerase 1; Releases the supercoiling and torsional tension of DNA, which is introduced during the DNA replication and transcription, by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA- (5'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 3'-OH DNA strand. The free DNA strand then undergoes passage around the unbroken strand, thus removing DNA supe [...] (849 aa)
zimCTAG modification methylase. (367 aa)
mutYA/G-specific adenine glycosylase. (339 aa)
top6ADNA topoisomerase 6 subunit A; Relaxes both positive and negative superturns and exhibits a strong decatenase activity; Belongs to the TOP6A family. (370 aa)
gyrBDNA gyrase subunit B; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state. Negative supercoiling favors strand separation, and DNA replication, transcription, recombination and repair, all of which involve strand separation. Also able to catalyze the interconversion of other topological isomers of dsDNA rings, including catenanes and knotted rings. Type II topoisomerases break and join 2 DNA strands simultaneously in an ATP-dependent manner. (639 aa)
gyrADNA gyrase subunit A; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state. Negative supercoiling favors strand separation, and DNA replication, transcription, recombination and repair, all of which involve strand separation. Also able to catalyze the interconversion of other topological isomers of dsDNA rings, including catenanes and knotted rings. Type II topoisomerases break and join 2 DNA strands simultaneously in an ATP-dependent manner. (848 aa)
Nmlp_1031DEAD/DEAH box helicase. (794 aa)
polXDNA-directed DNA polymerase X. (580 aa)
rfcAReplication factor C small subunit; Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA; Belongs to the activator 1 small subunits family. RfcS subfamily. (324 aa)
Nmlp_1085Helicase domain protein. (579 aa)
ligADNA ligase (NAD); DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double- stranded DNA using NAD as a coenzyme and as the energy source for the reaction. It is essential for DNA replication and repair of damaged DNA. (690 aa)
radADNA repair and recombination protein RadA; Involved in DNA repair and in homologous recombination. Binds and assemble on single-stranded DNA to form a nucleoprotein filament. Hydrolyzes ATP in a ssDNA-dependent manner and promotes DNA strand exchange between homologous DNA molecules. (345 aa)
Your Current Organism:
Natronomonas moolapensis
NCBI taxonomy Id: 268739
Other names: N. moolapensis 8.8.11, Natronomonas moolapensis 8.8.11, Natronomonas moolapensis DSM 18674, Natronomonas moolapensis JCM 14361, Natronomonas moolapensis str. 8.8.11, Natronomonas moolapensis strain 8.8.11, haloarchaeon CSW8.8.11
Server load: low (18%) [HD]
STRING is a Core Data Resource as designated by Global Biodata Coalition and ELIXIR.