STRINGSTRING
bioN bioN Nmlp_2189 Nmlp_2189 trkA3 trkA3 trkA4 trkA4 Nmlp_2439 Nmlp_2439 PotA PotA Nmlp_2491 Nmlp_2491 Nmlp_2572 Nmlp_2572 znuC3 znuC3 CbiO CbiO CbiQ CbiQ CbiM CbiM Nmlp_2651 Nmlp_2651 Nmlp_2715 Nmlp_2715 znuC2 znuC2 Nmlp_2836 Nmlp_2836 Nmlp_2978 Nmlp_2978 Nmlp_3128 Nmlp_3128 Nmlp_3148 Nmlp_3148 flaCE flaCE sdhA2 sdhA2 dadA dadA Nmlp_3393 Nmlp_3393 pchA3 pchA3 Nmlp_3404 Nmlp_3404 nuoCD nuoCD znuC1 znuC1 atpB atpB Nmlp_3621 Nmlp_3621 Nmlp_3812 Nmlp_3812 sec11 sec11 hel308a hel308a mutS5a mutS5a Nmlp_1012 Nmlp_1012 Nmlp_1031 Nmlp_1031 Nmlp_1096 Nmlp_1096 Nmlp_1257 Nmlp_1257 atpD atpD atpA atpA atpC atpC atpE atpE atpK atpK atpI atpI atpH atpH tatC2 tatC2 tatC1 tatC1 Nmlp_1438 Nmlp_1438 ftsY ftsY mrpE mrpE pchA2 pchA2 bioM bioM Nmlp_1725 Nmlp_1725 Nmlp_1737 Nmlp_1737 mutS5b mutS5b Nmlp_1853 Nmlp_1853 Nmlp_1868 Nmlp_1868 phnE phnE phnG phnG sdhC sdhC sdhD sdhD sdhB sdhB sdhA1 sdhA1 tatA1 tatA1 tatA2 tatA2 trkA2 trkA2
Nodes:
Network nodes represent proteins
splice isoforms or post-translational modifications are collapsed, i.e. each node represents all the proteins produced by a single, protein-coding gene locus.
Node Color
colored nodes:
query proteins and first shell of interactors
white nodes:
second shell of interactors
Node Content
empty nodes:
proteins of unknown 3D structure
filled nodes:
a 3D structure is known or predicted
Edges:
Edges represent protein-protein associations
associations are meant to be specific and meaningful, i.e. proteins jointly contribute to a shared function; this does not necessarily mean they are physically binding to each other.
Known Interactions
from curated databases
experimentally determined
Predicted Interactions
gene neighborhood
gene fusions
gene co-occurrence
Others
textmining
co-expression
protein homology
Your Input:
bioNABC-type transport system permease protein (probable substrate biotin). (236 aa)
Nmlp_2189Uncharacterized protein. (1396 aa)
trkA3TrkA domain protein. (221 aa)
trkA4TrkA domain protein. (217 aa)
Nmlp_2439Uncharacterized protein. (251 aa)
PotAABC-type transport system ATP-binding protein. (363 aa)
Nmlp_2491IS1341-type transposase ISNamo20. (439 aa)
Nmlp_2572IS1341-type transposase ISNamo24; Gene has been targetted by a transposon; locus_tag: Nmlp_2571; product: small CPxCG-related zinc finger protein (nonfunctional); conceptual translation after in silico reconstruction: MSTTDLSTLGDCPRCSASVTSIDVLIEYKIDGQPAVYAVHAEC PGCQAVIKPA. (434 aa)
znuC3ABC-type transport system ATP-binding protein (probable substrate zinc). (261 aa)
CbiOABC-type transport system ATP-binding protein (probable substrate cobalt/nickel/biotin). (292 aa)
CbiQABC-type transport system permease protein (probable substrate cobalt/nickel/biotin). (270 aa)
CbiMABC-type transport system permease protein (probable substrate cobalt/nickel/biotin). (226 aa)
Nmlp_2651IS1341-type transposase ISNamo25. (410 aa)
Nmlp_2715ABC-type transport system ATP-binding protein. (395 aa)
znuC2ABC-type transport system ATP-binding protein (probable substrate zinc). (245 aa)
Nmlp_2836Small CPxCG-related zinc finger protein. (81 aa)
Nmlp_2978TrkA-N domain protein. (143 aa)
Nmlp_3128TrkA-N domain protein. (135 aa)
Nmlp_3148IS1341-type transposase ISNamo20. (439 aa)
flaCEFla cluster protein FlaCE. (549 aa)
sdhA2Succinate dehydrogenase subunit A; Deleted EC_number 1.3.99.1. (596 aa)
dadAHomolog to D-aspartate oxidase. (361 aa)
Nmlp_3393DUF106 family protein. (298 aa)
pchA3Ion channel pore / TrkA domain protein. (551 aa)
Nmlp_3404Peptidase S26 domain protein. (384 aa)
nuoCDNADH dehydrogenase-like complex subunit CD. (559 aa)
znuC1ABC-type transport system ATP-binding protein (probable substrate zinc). (247 aa)
atpBA-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit. (472 aa)
Nmlp_3621ABC-type transport system ATP-binding protein (probable substrate glucose). (562 aa)
Nmlp_3812ABC-type transport system permease protein. (263 aa)
sec11Signal peptidase I. (294 aa)
hel308aATP-dependent DNA helicase Hel308; DNA-dependent ATPase and 3'-5' DNA helicase that may be involved in repair of stalled replication forks. (769 aa)
mutS5aDNA mismatch repair protein MutS; Has ATPase and non-specific DNA-binding activities. Belongs to the DNA mismatch repair MutS family. Archaeal Muts2 subfamily. (678 aa)
Nmlp_1012IS1341-type transposase ISNamo20. (439 aa)
Nmlp_1031DEAD/DEAH box helicase. (794 aa)
Nmlp_1096IS1341-type transposase ISNamo20. (439 aa)
Nmlp_1257MJ0936 family phosphodiesterase. (173 aa)
atpDA-type ATP synthase subunit D; Produces ATP from ADP in the presence of a proton gradient across the membrane. (230 aa)
atpAA-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family. (585 aa)
atpCA-type ATP synthase subunit C; Produces ATP from ADP in the presence of a proton gradient across the membrane. (352 aa)
atpEA-type ATP synthase subunit E; Produces ATP from ADP in the presence of a proton gradient across the membrane. (192 aa)
atpKA-type ATP synthase subunit K. (88 aa)
atpIA-type ATP synthase subunit I; Belongs to the V-ATPase 116 kDa subunit family. (753 aa)
atpHA-type ATP synthase subunit H. (112 aa)
tatC2Sec-independent protein translocase subunit TatC; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in their signal peptide across membranes. (777 aa)
tatC1Sec-independent protein translocase subunit TatC; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in their signal peptide across membranes. (259 aa)
Nmlp_1438IS1341-type transposase ISNamo22; Product: nitroreductase family protein (nonfunctional); part of the region does not belong to this CDS as coordinates speficy only the outer boundaries; gene has been targetted by a transposon. (445 aa)
ftsYSignal recognition particle receptor FtsY; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the signal recognition particle (SRP) and the ribosome-nascent chain (RNC). (359 aa)
mrpEMrp-type sodium/proton antiporter system subunit E. (376 aa)
pchA2Ion channel pore / TrkA domain protein. (553 aa)
bioMABC-type transport system ATP-binding protein (probable substrate biotin). (231 aa)
Nmlp_1725ABC-type transport system permease protein. (232 aa)
Nmlp_1737DUF499 domain protein. (1124 aa)
mutS5bDNA mismatch repair protein MutS. (582 aa)
Nmlp_1853IS1341-type transposase ISNamo21; Gene has been targetted by a transposon; locus_tag: Nmlp_1855; conceptual translation after in silico reconstruction: MSTDNSDDTTEHHAHEHRDVGGPGYPTPAAMRTESGREQTAYV MAPRVGMQNDGPGFVGVVDLDPASDTYSELIDTVEMPNKGDELHHFGWNACSSSCHAE GLSRQYLIVPGQRSSRIHVIDAEEPRDPEIVTVIEPEELFEYDLSAPHTVHCVPGGKI VISMLGDADGELPGGFLQLDQEDFSIDGRWEADRGAMEMNYDYWYQPRYDVLISSEWA APNTYYPGFDLDDVEAGNYGDSIHIWSWDDREHVQTLEFGDAGRIPLEVRMSHNPEET QGYVGAALSSNIIRFYESTDGAWEWDVVIDEDPREHEDWDMPVPPLIIDILLSLDDQY LFFSNWLHGDVRMYDVSDAANPRLVDRVWAGGLFGDRQEIQDKEIRGAPQMLQLSRDG TRLYWTTSLFSSWDNQFFPEMAEEGSLMFKADVFPDEGRLDL [...] (459 aa)
Nmlp_1868HEAT-PBS family protein. (449 aa)
phnEABC-type transport system permease protein (probable substrate phosphate/phosphonate). (332 aa)
phnGAlkylphosphonate cleavage complex subunit PhnG. (153 aa)
sdhCSuccinate dehydrogenase subunit C; Deleted EC_number 1.3.99.1. (130 aa)
sdhDSuccinate dehydrogenase subunit D; Deleted EC_number 1.3.99.1. (121 aa)
sdhBSuccinate dehydrogenase subunit B; Deleted EC_number 1.3.99.1. (285 aa)
sdhA1Succinate dehydrogenase subunit A; Deleted EC_number 1.3.99.1. (611 aa)
tatA1Sec-independent protein translocase subunit TatA; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. (140 aa)
tatA2Sec-independent protein translocase subunit TatA; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. (92 aa)
trkA2TrkA domain protein. (228 aa)
Your Current Organism:
Natronomonas moolapensis
NCBI taxonomy Id: 268739
Other names: N. moolapensis 8.8.11, Natronomonas moolapensis 8.8.11, Natronomonas moolapensis DSM 18674, Natronomonas moolapensis JCM 14361, Natronomonas moolapensis str. 8.8.11, Natronomonas moolapensis strain 8.8.11, haloarchaeon CSW8.8.11
Server load: low (38%) [HD]
STRING is a Core Data Resource as designated by Global Biodata Coalition and ELIXIR.