(21 nodes) Innate Immune System network (Natronomonas moolapensis)

Nodes:

Network nodes represent proteins

splice isoforms or post-translational modifications are collapsed, i.e. each node represents all the proteins produced by a single, protein-coding gene locus.

Node Color

colored nodes:
query proteins and first shell of interactors

white nodes:
second shell of interactors

Node Content

empty nodes:
proteins of unknown 3D structure

filled nodes:
a 3D structure is known or predicted

Edges:

Edges represent protein-protein associations

associations are meant to be specific and meaningful, i.e. proteins jointly contribute to a shared function; this does not necessarily mean they are physically binding to each other.

Known Interactions

from curated databases

experimentally determined

Predicted Interactions

gene neighborhood

gene fusions

gene co-occurrence

Others

textmining

co-expression

protein homology

Your Input:
	mre11	DNA double-strand break repair protein Mre11; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Mre11 binds to DSB ends and has both double-stranded 3'-5' exonuclease activity and single-stranded endonuclease activity; Belongs to the MRE11/RAD32 family. (465 aa)
	apt1	HGPRTase-like protein; May catalyze a purine salvage reaction, the substrate is unknown. (189 aa)
	serS	serine--tRNA ligase; Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L- seryl-tRNA(Sec), which will be further converted into selenocysteinyl- tRNA(Sec). (458 aa)
	pgi	Glucose-6-phosphate isomerase; Belongs to the GPI family. (428 aa)
	psmA	Proteasome alpha subunit; Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. (249 aa)
	cdd	Cytidine deaminase; Gene has frameshifts; locus_tag: Nmlp_2472; product: IS1341-type transposase NmIRS25 (nonfunctional); conceptual translation after in silico reconstruction: MEYSHRYPAYPTQQVVGELERHIDIHRQAYNYTRYEYENVDAD DIGSAYRHHYRLPGWKDEFPAFSEINSKALQRTVTRFYQNLDGLSEKKQNGRKVEKLD WKSPREFQSITYSQSGFELKNTSGRRATLWLSKIGDIIRYHREIDEADIKEVTVKKET TGEWFVSFGLEPDDADLPEKPAVDSLRRLSWKEQGSNNYERQRREVAKVKRHIRRKVL DYQHKITTWLVRAYDAVFVEDLEVKEMLEQSHNAHNKQDAAWRQFITVIEYKADLYGC HVVQPEAAGTTKECAACGVETAKPISVREHSCPACGFECDRDANAAMNVLERGCSELG LGWPEDTPVEAALPTDTTQFESVSATRVIEAGSLGVVRKTKSSAMTRRSAPRTT. (130 aa)
	psmB	Proteasome beta subunit; Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. (239 aa)
	deoC1	Deoxyribose-phosphate aldolase. (159 aa)
	deoC2	Deoxyribose-phosphate aldolase; Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5- phosphate; Belongs to the DeoC/FbaB aldolase family. DeoC type 1 subfamily. (223 aa)
	pncB	Nicotinate phosphoribosyltransferase. (379 aa)
	pucM	5-hydroxyisourate hydrolase. (116 aa)
	tef1a	Translation elongation factor aEF-1 alpha subunit; This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis. Belongs to the TRAFAC class translation factor GTPase superfamily. Classic translation factor GTPase family. EF-Tu/EF-1A subfamily. (421 aa)
	hemB	Porphobilinogen synthase; Belongs to the ALAD family. (326 aa)
	atpA	A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family. (585 aa)
	atpF	A-type ATP synthase subunit F; Produces ATP from ADP in the presence of a proton gradient across the membrane. (106 aa)
	atpC	A-type ATP synthase subunit C; Produces ATP from ADP in the presence of a proton gradient across the membrane. (352 aa)
	atpE	A-type ATP synthase subunit E; Produces ATP from ADP in the presence of a proton gradient across the membrane. (192 aa)
	atpI	A-type ATP synthase subunit I; Belongs to the V-ATPase 116 kDa subunit family. (753 aa)
	apt2	Purine phosphoribosyltransferase (adenine phosphoribosyltransferase, xanthine-guanine phosphoribosyltransferase). (238 aa)
	atpD	A-type ATP synthase subunit D; Produces ATP from ADP in the presence of a proton gradient across the membrane. (230 aa)
	atpB	A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit. (472 aa)

Your Current Organism:

Natronomonas moolapensis

NCBI taxonomy Id: 268739
Other names: N. moolapensis 8.8.11, Natronomonas moolapensis 8.8.11, Natronomonas moolapensis DSM 18674, Natronomonas moolapensis JCM 14361, Natronomonas moolapensis str. 8.8.11, Natronomonas moolapensis strain 8.8.11, haloarchaeon CSW8.8.11

Send network to Cytoscape

Export your current network:

... as a bitmap image:

download

file format is 'PNG': portable network graphic

... as a high-resolution bitmap:

download

same PNG format, but at higher resolution

... as a vector graphic:

download

SVG: scalable vector graphic - can be opened and edited in Illustrator, CorelDraw, Dia, etc

... as short tabular text output:

download

TSV: tab separated values - can be opened in Excel and Cytoscape (lists only one-way edges: A-B)

... as tabular text output:

download

TSV: tab separated values - can be opened in Excel (lists reciprocal edges: A-B,B-A)

... as an XML summary:

download

structured XML interaction data, according to the 'PSI-MI' data standard

... protein node degrees:

download

node degree of proteins in your network (given the current score cut-off)

... network coordinates:

download

a flat-file format describing the coordinates and colors of nodes in the network

... protein sequences:

download

MFA: multi-fasta format - containing the aminoacid sequences in the network

... protein annotations:

download

a tab-delimited file describing the names, domains and descriptions of proteins in your network

... functional annotations:

download

a tab-delimited file containing all known functional terms of proteins in your network

Browse interactions in tabular form:

node1	node2	node1 accession	node2 accession	node1 annotation	node2 annotation	score
apt1	apt2	Nmlp_2103	Nmlp_1547	HGPRTase-like protein; May catalyze a purine salvage reaction, the substrate is unknown.	Purine phosphoribosyltransferase (adenine phosphoribosyltransferase, xanthine-guanine phosphoribosyltransferase).	0.900
apt2	apt1	Nmlp_1547	Nmlp_2103	Purine phosphoribosyltransferase (adenine phosphoribosyltransferase, xanthine-guanine phosphoribosyltransferase).	HGPRTase-like protein; May catalyze a purine salvage reaction, the substrate is unknown.	0.900
atpA	atpB	Nmlp_1309	Nmlp_1308	A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family.	A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.	0.999
atpA	atpC	Nmlp_1309	Nmlp_1311	A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family.	A-type ATP synthase subunit C; Produces ATP from ADP in the presence of a proton gradient across the membrane.	0.999
atpA	atpD	Nmlp_1309	Nmlp_1307	A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family.	A-type ATP synthase subunit D; Produces ATP from ADP in the presence of a proton gradient across the membrane.	0.999
atpA	atpE	Nmlp_1309	Nmlp_1312	A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family.	A-type ATP synthase subunit E; Produces ATP from ADP in the presence of a proton gradient across the membrane.	0.999
atpA	atpF	Nmlp_1309	Nmlp_1310	A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family.	A-type ATP synthase subunit F; Produces ATP from ADP in the presence of a proton gradient across the membrane.	0.999
atpA	atpI	Nmlp_1309	Nmlp_1315	A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family.	A-type ATP synthase subunit I; Belongs to the V-ATPase 116 kDa subunit family.	0.999
atpA	tef1a	Nmlp_1309	Nmlp_3831	A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family.	Translation elongation factor aEF-1 alpha subunit; This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis. Belongs to the TRAFAC class translation factor GTPase superfamily. Classic translation factor GTPase family. EF-Tu/EF-1A subfamily.	0.570
atpB	atpA	Nmlp_1308	Nmlp_1309	A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.	A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family.	0.999
atpB	atpC	Nmlp_1308	Nmlp_1311	A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.	A-type ATP synthase subunit C; Produces ATP from ADP in the presence of a proton gradient across the membrane.	0.999
atpB	atpD	Nmlp_1308	Nmlp_1307	A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.	A-type ATP synthase subunit D; Produces ATP from ADP in the presence of a proton gradient across the membrane.	0.999
atpB	atpE	Nmlp_1308	Nmlp_1312	A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.	A-type ATP synthase subunit E; Produces ATP from ADP in the presence of a proton gradient across the membrane.	0.999
atpB	atpF	Nmlp_1308	Nmlp_1310	A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.	A-type ATP synthase subunit F; Produces ATP from ADP in the presence of a proton gradient across the membrane.	0.999
atpB	atpI	Nmlp_1308	Nmlp_1315	A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.	A-type ATP synthase subunit I; Belongs to the V-ATPase 116 kDa subunit family.	0.999
atpB	pgi	Nmlp_1308	Nmlp_2148	A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.	Glucose-6-phosphate isomerase; Belongs to the GPI family.	0.626
atpC	atpA	Nmlp_1311	Nmlp_1309	A-type ATP synthase subunit C; Produces ATP from ADP in the presence of a proton gradient across the membrane.	A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta chains family.	0.999
atpC	atpB	Nmlp_1311	Nmlp_1308	A-type ATP synthase subunit C; Produces ATP from ADP in the presence of a proton gradient across the membrane.	A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.	0.999
atpC	atpD	Nmlp_1311	Nmlp_1307	A-type ATP synthase subunit C; Produces ATP from ADP in the presence of a proton gradient across the membrane.	A-type ATP synthase subunit D; Produces ATP from ADP in the presence of a proton gradient across the membrane.	0.999
atpC	atpE	Nmlp_1311	Nmlp_1312	A-type ATP synthase subunit C; Produces ATP from ADP in the presence of a proton gradient across the membrane.	A-type ATP synthase subunit E; Produces ATP from ADP in the presence of a proton gradient across the membrane.	0.999

page 1 of 4

Server load: low (14%) [HD]

Permalink

Network

Neighborhood

Experiments

Cooccurrence

Databases

Coexpression

Textmining

Fusion

© STRING Consortium 2025

Credits

Access

Info

About