Your Input: | |
| | Nmlp_1007 | Alpha/beta hydrolase fold protein. (260 aa) |
| | rpiA | Ribose-5-phosphate isomerase; Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate. (235 aa) |
| | lysC | Aspartate kinase; Belongs to the aspartokinase family. (394 aa) |
| | azf | Glucose-6-phosphate 1-dehydrogenase (NAD); Catalyzes the NAD-dependent oxidation of glucose 6-phosphate to 6-phosphogluconolactone; Belongs to the NAD(P)-dependent epimerase/dehydratase family. (255 aa) |
| | maeB1 | Malate dehydrogenase (oxaloacetate-decarboxylating). (752 aa) |
| | mer | Probable 5,10-methylenetetrahydrofolate reductase; Catalyzes the oxidation of methyl-H(4)MPT to methylene- H(4)MPT. (329 aa) |
| | cofE | Coenzyme F420:L-glutamate ligase; Catalyzes the GTP-dependent successive addition of two or more gamma-linked L-glutamates to the L-lactyl phosphodiester of 7,8- didemethyl-8-hydroxy-5-deazariboflavin (F420-0) to form coenzyme F420- 0-glutamyl-glutamate (F420-2) or polyglutamated F420 derivatives. (250 aa) |
| | fba2 | 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase. (262 aa) |
| | dsa | Dihydrolipoamide S-acyltransferase. (532 aa) |
| | oxdhB | 2-oxo-3-methylvalerate dehydrogenase E1 component beta subunit. (329 aa) |
| | oxdhA1 | 2-oxo-3-methylvalerate dehydrogenase E1 component alpha subunit. (373 aa) |
| | Nmlp_1360 | Probable amidase. (489 aa) |
| | kdgK | 2-keto-3-deoxygluconate kinase; Belongs to the carbohydrate kinase PfkB family. (318 aa) |
| | gnaD | D-gluconate dehydratase. (411 aa) |
| | gdh | Glucose 1-dehydrogenase; Catalyzes the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate via gluconolactone. Can utilize both NAD(+) and NADP(+) as electron acceptor. Is involved in the degradation of glucose through a modified Entner-Doudoroff pathway. (353 aa) |
| | aldH2 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. (478 aa) |
| | pykA | Pyruvate kinase; Belongs to the pyruvate kinase family. (580 aa) |
| | mgsA | Methylglyoxal synthase; Catalyzes the formation of methylglyoxal from dihydroxyacetone phosphate. (127 aa) |
| | hadL | Haloacid dehalogenase, type II. (227 aa) |
| | gndA | 6-phosphogluconate dehydrogenase (NAD-dependent, decarboxylating); Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NAD to NADH. (299 aa) |
| | serB | Phosphoserine phosphatase; This gene seems complete but lacks its stop codon so that the reading frame continues into an adjacent ISH element; locus_tag: Nmlp_1419; product: UspA domain protein (nonfunctional); conceptual translation after in silico reconstruction: MSDDRLERPHAAERRHGRGRRVGARRRTDRLCAASRPADRTGT VAGGDRGPGVESAVEAGGPAETTLLYADRHDADRVATGGHGADPNGSFGRLVGAVATT AVAGGPAAVTVTVGR. (239 aa) |
| | serA1 | D-3-phosphoglycerate dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. (526 aa) |
| | nitB | Nitrilase. (367 aa) |
| | gap | Glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) (phosphorylating). (338 aa) |
| | aor3 | Aldehyde ferredoxin oxidoreductase. (559 aa) |
| | Nmlp_1665 | DUF4147 domain protein. (433 aa) |
| | aldH3 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. (508 aa) |
| | thrC1 | Threonine synthase; Catalyzes the gamma-elimination of phosphate from L- phosphohomoserine and the beta-addition of water to produce L- threonine. (436 aa) |
| | Nmlp_1822 | AhpD family protein. (185 aa) |
| | ppc | Phosphoenolpyruvate carboxylase. (897 aa) |
| | sdhC | Succinate dehydrogenase subunit C; Deleted EC_number 1.3.99.1. (130 aa) |
| | sdhD | Succinate dehydrogenase subunit D; Deleted EC_number 1.3.99.1. (121 aa) |
| | sdhB | Succinate dehydrogenase subunit B; Deleted EC_number 1.3.99.1. (285 aa) |
| | sdhA1 | Succinate dehydrogenase subunit A; Deleted EC_number 1.3.99.1. (611 aa) |
| | cysE | Serine O-acetyltransferase; Gene has a frameshift and is truncated at both termini; locus_tag: Nmlp_1987; product: DNA N-glycosylase (nonfunctional). (188 aa) |
| | mmcB | methylmalonyl-CoA mutase subunit B (cobalamin-binding subunit). (138 aa) |
| | fumC | Fumarate hydratase; Involved in the TCA cycle. Catalyzes the stereospecific interconversion of fumarate to L-malate; Belongs to the class-II fumarase/aspartase family. Fumarase subfamily. (471 aa) |
| | mch | Probable methenyltetrahydrofolate cyclohydrolase; Catalyzes the hydrolysis of methenyl-H(4)MPT(+) to 5-formyl- H(4)MPT. (311 aa) |
| | mce | methylmalonyl-CoA epimerase. (127 aa) |
| | mmcA2 | methylmalonyl-CoA mutase subunit A. (556 aa) |
| | nirA2 | Probable sulfite/nitrite reductase (ferredoxin). (584 aa) |
| | pgi | Glucose-6-phosphate isomerase; Belongs to the GPI family. (428 aa) |
| | gabD | Succinate-semialdehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. (534 aa) |
| | gpmI | Phosphoglycerate mutase,2,3-biphosphateglycerate-independent type; Catalyzes the interconversion of 2-phosphoglycerate and 3- phosphoglycerate; Belongs to the BPG-independent phosphoglycerate mutase family. (513 aa) |
| | serA3 | Probable D-2-hydroxyacid dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. (321 aa) |
| | Nmlp_2217 | Alpha/beta hydrolase fold protein. (326 aa) |
| | lpdA1 | Dihydrolipoyl dehydrogenase. (474 aa) |
| | oxdhA2 | Probable 2-oxoacid dehydrogenase E1 component alpha subunit. (372 aa) |
| | Nmlp_2332 | Peptidase M20 family protein (homolog to succinyl-diaminopimelate desuccinylase). (428 aa) |
| | dapD | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. (278 aa) |
| | aceA | Isocitrate lyase. (355 aa) |
| | aceB | Malate synthase. (436 aa) |
| | pgk | Phosphoglycerate kinase; Belongs to the phosphoglycerate kinase family. (395 aa) |
| | cofC | 2-phospho-L-lactate guanylyltransferase; Guanylyltransferase that catalyzes the activation of phosphoenolpyruvate (PEP) as enolpyruvoyl-2-diphospho-5'-guanosine, via the condensation of PEP with GTP. It is involved in the biosynthesis of coenzyme F420, a hydride carrier cofactor; Belongs to the CofC family. (202 aa) |
| | cofG | 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 1; Catalyzes the radical-mediated synthesis of 7,8-didemethyl-8- hydroxy-5-deazariboflavin (FO) from 5-amino-5-(4-hydroxybenzyl)-6-(D- ribitylimino)-5,6-dihydrouracil. (358 aa) |
| | Nmlp_2695 | Metal-dependent hydrolase domain protein. (275 aa) |
| | fdhA | Formate dehydrogenase alpha subunit. (675 aa) |
| | acaB1 | acetyl-CoA C-acetyltransferase catalytic subunit. (384 aa) |
| | gltS | glutamate--tRNA(Glu/Gln) ligase; Catalyzes the attachment of glutamate to tRNA(Glu) in a two- step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu). (571 aa) |
| | eno | Enolase; Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. It is essential for the degradation of carbohydrates via glycolysis; Belongs to the enolase family. (398 aa) |
| | tssA2 | Rhodanese domain protein. (265 aa) |
| | tssA1 | Rhodanese domain protein. (289 aa) |
| | acdA | acetate--CoA ligase (ADP-forming). (697 aa) |
| | gdhA | Glutamate dehydrogenase; Gene has frameshifts; locus_tag: Nmlp_2832; product: homolog to citrate lyase beta subunit (nonfunctional); conceptual translation after in silico reconstruction: MARRSVLFSPGDRPELMRNAPHTGADTVVFDLEDAVVPEAKAA AREAVAGVLGDPAFEPDCEVCVRLNPDPETAALDAEAIAANDPRLDSIAVPEAESAGD VRAIHELVAARGHDRPVIALCESAAGVLGAEDIAAADPVEAVAFGVVDIGATRTGAEI AHARQHDVLAPGAAGVDAVDTLVTDIGAEDHLKSEAGVARQLGYDGKMAIHPAQVEII NEAFTPPPENVEWAKCVLTAADAAEQKGRGVARVDDEMVDAPLISRAETVPERHEAAE RD; Belongs to the Glu/Leu/Phe/Val dehydrogenases family. (419 aa) |
| | acyP | Acylphosphatase. (92 aa) |
| | fba1 | Fructose-bisphosphate aldolase, class 1. (264 aa) |
| | fbp | Fructose-1,6-bisphosphatase. (291 aa) |
| | thrC3 | Threonine synthase. (391 aa) |
| | dapB | 4-hydroxy-tetrahydrodipicolinate reductase; Catalyzes the conversion of 4-hydroxy-tetrahydrodipicolinate (HTPA) to tetrahydrodipicolinate; Belongs to the DapB family. (246 aa) |
| | dapA | 4-hydroxy-tetrahydrodipicolinate synthase; Catalyzes the condensation of (S)-aspartate-beta-semialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA). (294 aa) |
| | icd | Isocitrate dehydrogenase (NADP). (418 aa) |
| | Nmlp_2984 | Homolog to sulfate adenylyltransferase small subunit. (322 aa) |
| | gltB | Glutamate synthase large subunit. (1507 aa) |
| | lysA | Diaminopimelate decarboxylase; Specifically catalyzes the decarboxylation of meso- diaminopimelate (meso-DAP) to L-lysine. (414 aa) |
| | glyA | Serine hydroxymethyltransferase; Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. Also exhibits THF-independent aldolase activity toward beta- hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism. (424 aa) |
| | folD | Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase; Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10- methenyltetrahydrofolate to 10-formyltetrahydrofolate. (297 aa) |
| | korB2 | Oxoglutarate--ferredoxin oxidoreductase beta subunit. (289 aa) |
| | acaB3 | acetyl-CoA C-acyltransferase. (392 aa) |
| | acs1 | acyl-CoA synthetase. (672 aa) |
| | mmcA1 | methylmalonyl-CoA mutase subunit A. (565 aa) |
| | hbd | 3-hydroxyacyl-CoA dehydrogenase. (287 aa) |
| | maeB2 | Malate dehydrogenase (oxaloacetate-decarboxylating). (752 aa) |
| | cysK | Cysteine synthase. (329 aa) |
| | ppsA | Phosphoenolpyruvate synthase; Catalyzes the phosphorylation of pyruvate to phosphoenolpyruvate; Belongs to the PEP-utilizing enzyme family. (771 aa) |
| | citZ | Citrate synthase. (378 aa) |
| | porB | Pyruvate--ferredoxin oxidoreductase beta subunit. (312 aa) |
| | porA | Pyruvate--ferredoxin oxidoreductase alpha subunit. (628 aa) |
| | sirC | Precorrin-2 oxidase / ferrochelatase. (215 aa) |
| | hemA | glutamyl-tRNA reductase; Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA). (454 aa) |
| | pmm1 | Phosphohexomutase (phosphoglucomutase / phosphomannomutase); Belongs to the phosphohexose mutase family. (455 aa) |
| | tpiA | Triosephosphate isomerase; Involved in the gluconeogenesis. Catalyzes stereospecifically the conversion of dihydroxyacetone phosphate (DHAP) to D- glyceraldehyde-3-phosphate (G3P); Belongs to the triosephosphate isomerase family. (211 aa) |
| | thrB | Homoserine kinase; Catalyzes the ATP-dependent phosphorylation of L-homoserine to L-homoserine phosphate; Belongs to the GHMP kinase family. Homoserine kinase subfamily. (292 aa) |
| | sucD | succinate--CoA ligase (ADP-forming) alpha subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit. (289 aa) |
| | sucC | succinate--CoA ligase (ADP-forming) beta subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit. (382 aa) |
| | pccB | propionyl-CoA carboxylase carboxyltransferase component. (516 aa) |
| | pccX | propionyl-CoA carboxylase small subunit. (83 aa) |
| | pccA | propionyl-CoA carboxylase biotin carboxylase component. (614 aa) |
| | acaB2 | acetyl-CoA C-acetyltransferase. (388 aa) |
| | cofH | 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 2. (448 aa) |
| | sdhA2 | Succinate dehydrogenase subunit A; Deleted EC_number 1.3.99.1. (596 aa) |
| | cofD | 2-phospho-L-lactate transferase; Catalyzes the transfer of the phosphoenolpyruvate moiety from enoylpyruvoyl-2-diphospho-5'-guanosine (EPPG) to 7,8-didemethyl-8- hydroxy-5-deazariboflavin (FO) with the formation of dehydro coenzyme F420-0 and GMP. (334 aa) |
| | ureA | Urease gamma subunit; Belongs to the urease gamma subunit family. (109 aa) |
| | ureC | Urease alpha subunit. (570 aa) |
| | ureB | Urease beta subunit; Belongs to the urease beta subunit family. (127 aa) |
| | asd | Aspartate-semialdehyde dehydrogenase. (344 aa) |
| | korA | Oxoglutarate--ferredoxin oxidoreductase alpha subunit. (587 aa) |
| | korB1 | Oxoglutarate--ferredoxin oxidoreductase beta subunit. (289 aa) |
| | hemC | Hydroxymethylbilane synthase (porphobilinogen deaminase). (357 aa) |
| | sirA | uroporphyrin-III C-methyltransferase; Belongs to the precorrin methyltransferase family. (257 aa) |
| | hemD | uroporphyrinogen-III synthase. (238 aa) |
| | prsA | Ribose-phosphate pyrophosphokinase; Involved in the biosynthesis of the central metabolite phospho-alpha-D-ribosyl-1-pyrophosphate (PRPP) via the transfer of pyrophosphoryl group from ATP to 1-hydroxyl of ribose-5-phosphate (Rib- 5-P). (277 aa) |
| | pucM | 5-hydroxyisourate hydrolase. (116 aa) |
| | pucL1 | Uricase; Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin. (307 aa) |
| | aor2 | Aldehyde ferredoxin oxidoreductase. (555 aa) |
| | aor1 | Aldehyde ferredoxin oxidoreductase; Product: probable DNA-binding protein (nonfunctional). (647 aa) |
| | acs4 | acyl-CoA synthetase. (654 aa) |
| | acs3 | acyl-CoA synthetase. (663 aa) |
| | korB3 | Oxoglutarate--ferredoxin oxidoreductase beta subunit. (287 aa) |
| | Nmlp_3756 | Probable oxidoreductase (aldo-keto reductase family protein). (272 aa) |
| | citB | Aconitate hydratase. (661 aa) |
| | Nmlp_3776 | CobC/GpmA family phosphatase. (203 aa) |
| | adh | Alcohol dehydrogenase. (355 aa) |
| | glnA | Glutamine synthetase. (456 aa) |
| | hom | Homoserine dehydrogenase. (314 aa) |
| | hemL | Glutamate-1-semialdehyde 2,1-aminomutase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. HemL subfamily. (446 aa) |
| | hemB | Porphobilinogen synthase; Belongs to the ALAD family. (326 aa) |
| | phaJ | (R)-specific enoyl-CoA hydratase. (215 aa) |
| | mdh | Malate dehydrogenase; Belongs to the LDH/MDH superfamily. (303 aa) |
