Export your current network:
... as a bitmap image:
file format is 'PNG': portable network graphic
... as a high-resolution bitmap:
same PNG format, but at higher resolution
... as a vector graphic:
SVG: scalable vector graphic - can be opened and edited in Illustrator, CorelDraw, Dia, etc
... as short tabular text output:
TSV: tab separated values - can be opened in Excel and Cytoscape (lists only one-way edges: A-B)
... as tabular text output:
TSV: tab separated values - can be opened in Excel (lists reciprocal edges: A-B,B-A)
... as an XML summary:
structured XML interaction data, according to the 'PSI-MI' data standard
... protein node degrees:
node degree of proteins in your network (given the current score cut-off)
... network coordinates:
a flat-file format describing the coordinates and colors of nodes in the network
... protein sequences:
MFA: multi-fasta format - containing the aminoacid sequences in the network
... protein annotations:
a tab-delimited file describing the names, domains and descriptions of proteins in your network
... functional annotations:
a tab-delimited file containing all known functional terms of protiens in your network
Browse interactions in tabular form:
node1 | node2 | node1 annotation | node2 annotation | score |
Nmlp_2180 | Nmlp_2181 | Site-specific DNA-methyltransferase (Cytosine-specific); Gene has an in-frame stop codon; locus_tag: Nmlp_2179; product: ISH14-type transposase ISNamo8 (nonfunctional); conceptual translation after in silico reconstruction: M...MPENARLNDNLDEIDLEFVEREATPRFLMKLSIQLHLAG LSLSNTVSILELFGVNRARSTVHNWVQKADLQPESGQNPDHVAVDETVIRLNDEYWLY AAVDPETNELLYTTLEPIINSVIAHAFFAELREKHDVEHAVFLIDGSHSLKDACRRHS LDFKYEKHGNRNSVERVFREIKRRTTSFSNCFSNAEADTADNWLRSFAFAWNQLI; Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family. | Uncharacterized protein. | 0.552 |
Nmlp_2180 | Nmlp_2182 | Site-specific DNA-methyltransferase (Cytosine-specific); Gene has an in-frame stop codon; locus_tag: Nmlp_2179; product: ISH14-type transposase ISNamo8 (nonfunctional); conceptual translation after in silico reconstruction: M...MPENARLNDNLDEIDLEFVEREATPRFLMKLSIQLHLAG LSLSNTVSILELFGVNRARSTVHNWVQKADLQPESGQNPDHVAVDETVIRLNDEYWLY AAVDPETNELLYTTLEPIINSVIAHAFFAELREKHDVEHAVFLIDGSHSLKDACRRHS LDFKYEKHGNRNSVERVFREIKRRTTSFSNCFSNAEADTADNWLRSFAFAWNQLI; Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family. | Uncharacterized protein. | 0.494 |
Nmlp_2181 | Nmlp_2180 | Uncharacterized protein. | Site-specific DNA-methyltransferase (Cytosine-specific); Gene has an in-frame stop codon; locus_tag: Nmlp_2179; product: ISH14-type transposase ISNamo8 (nonfunctional); conceptual translation after in silico reconstruction: M...MPENARLNDNLDEIDLEFVEREATPRFLMKLSIQLHLAG LSLSNTVSILELFGVNRARSTVHNWVQKADLQPESGQNPDHVAVDETVIRLNDEYWLY AAVDPETNELLYTTLEPIINSVIAHAFFAELREKHDVEHAVFLIDGSHSLKDACRRHS LDFKYEKHGNRNSVERVFREIKRRTTSFSNCFSNAEADTADNWLRSFAFAWNQLI; Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family. | 0.552 |
Nmlp_2181 | Nmlp_2182 | Uncharacterized protein. | Uncharacterized protein. | 0.443 |
Nmlp_2181 | Nmlp_2184 | Uncharacterized protein. | Uncharacterized protein. | 0.443 |
Nmlp_2181 | Nmlp_2185 | Uncharacterized protein. | Uncharacterized protein. | 0.443 |
Nmlp_2182 | Nmlp_2180 | Uncharacterized protein. | Site-specific DNA-methyltransferase (Cytosine-specific); Gene has an in-frame stop codon; locus_tag: Nmlp_2179; product: ISH14-type transposase ISNamo8 (nonfunctional); conceptual translation after in silico reconstruction: M...MPENARLNDNLDEIDLEFVEREATPRFLMKLSIQLHLAG LSLSNTVSILELFGVNRARSTVHNWVQKADLQPESGQNPDHVAVDETVIRLNDEYWLY AAVDPETNELLYTTLEPIINSVIAHAFFAELREKHDVEHAVFLIDGSHSLKDACRRHS LDFKYEKHGNRNSVERVFREIKRRTTSFSNCFSNAEADTADNWLRSFAFAWNQLI; Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family. | 0.494 |
Nmlp_2182 | Nmlp_2181 | Uncharacterized protein. | Uncharacterized protein. | 0.443 |
Nmlp_2182 | Nmlp_2184 | Uncharacterized protein. | Uncharacterized protein. | 0.773 |
Nmlp_2182 | Nmlp_2185 | Uncharacterized protein. | Uncharacterized protein. | 0.773 |
Nmlp_2184 | Nmlp_2181 | Uncharacterized protein. | Uncharacterized protein. | 0.443 |
Nmlp_2184 | Nmlp_2182 | Uncharacterized protein. | Uncharacterized protein. | 0.773 |
Nmlp_2184 | Nmlp_2185 | Uncharacterized protein. | Uncharacterized protein. | 0.773 |
Nmlp_2185 | Nmlp_2181 | Uncharacterized protein. | Uncharacterized protein. | 0.443 |
Nmlp_2185 | Nmlp_2182 | Uncharacterized protein. | Uncharacterized protein. | 0.773 |
Nmlp_2185 | Nmlp_2184 | Uncharacterized protein. | Uncharacterized protein. | 0.773 |