node1 | node2 | node1 accession | node2 accession | node1 annotation | node2 annotation | score |
Nmlp_2533 | dnaJ | Nmlp_2533 | Nmlp_3591 | DnaK domain protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2532; product: ISH4-type transposase NmIRS7 (nonfunctional); conceptual translation after in silico reconstruction: MFPIRRFVSESAAADLLQQVRWRDGVECPRCRSDLTVRNGSYR VYQRYLCENCGRTFNEKTGTIFAHAKLSLKEWYFTIYVFLRFNTSIRQIEAELNLSYR TVRRRVERFARALDSPSIRLSGPVEIDEVYVSAGLKGRERDSSRSRGLSTRGRGSYDG DKPPVFTLVDRGSDDRYVVPAKSAEESTIRLLLANCEQESITVYTDGFQAYEPLEDDA FTREYVVHGDGEYADGDIHVNTCESHASLTRRWLSPHRGVSKDKLTPYLRSFQLRCEL YRKRGDEALKHAFDAAL. | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, [...] | 0.999 |
Nmlp_2533 | dnaK | Nmlp_2533 | Nmlp_3588 | DnaK domain protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2532; product: ISH4-type transposase NmIRS7 (nonfunctional); conceptual translation after in silico reconstruction: MFPIRRFVSESAAADLLQQVRWRDGVECPRCRSDLTVRNGSYR VYQRYLCENCGRTFNEKTGTIFAHAKLSLKEWYFTIYVFLRFNTSIRQIEAELNLSYR TVRRRVERFARALDSPSIRLSGPVEIDEVYVSAGLKGRERDSSRSRGLSTRGRGSYDG DKPPVFTLVDRGSDDRYVVPAKSAEESTIRLLLANCEQESITVYTDGFQAYEPLEDDA FTREYVVHGDGEYADGDIHVNTCESHASLTRRWLSPHRGVSKDKLTPYLRSFQLRCEL YRKRGDEALKHAFDAAL. | Hsp70-type molecular chaperone DnaK; Acts as a chaperone. | 0.999 |
Nmlp_2533 | grpE | Nmlp_2533 | Nmlp_3586 | DnaK domain protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2532; product: ISH4-type transposase NmIRS7 (nonfunctional); conceptual translation after in silico reconstruction: MFPIRRFVSESAAADLLQQVRWRDGVECPRCRSDLTVRNGSYR VYQRYLCENCGRTFNEKTGTIFAHAKLSLKEWYFTIYVFLRFNTSIRQIEAELNLSYR TVRRRVERFARALDSPSIRLSGPVEIDEVYVSAGLKGRERDSSRSRGLSTRGRGSYDG DKPPVFTLVDRGSDDRYVVPAKSAEESTIRLLLANCEQESITVYTDGFQAYEPLEDDA FTREYVVHGDGEYADGDIHVNTCESHASLTRRWLSPHRGVSKDKLTPYLRSFQLRCEL YRKRGDEALKHAFDAAL. | DnaJ/DnaK ATPase stimulator GrpE; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several round [...] | 0.960 |
Nmlp_2533 | lon | Nmlp_2533 | Nmlp_3852 | DnaK domain protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2532; product: ISH4-type transposase NmIRS7 (nonfunctional); conceptual translation after in silico reconstruction: MFPIRRFVSESAAADLLQQVRWRDGVECPRCRSDLTVRNGSYR VYQRYLCENCGRTFNEKTGTIFAHAKLSLKEWYFTIYVFLRFNTSIRQIEAELNLSYR TVRRRVERFARALDSPSIRLSGPVEIDEVYVSAGLKGRERDSSRSRGLSTRGRGSYDG DKPPVFTLVDRGSDDRYVVPAKSAEESTIRLLLANCEQESITVYTDGFQAYEPLEDDA FTREYVVHGDGEYADGDIHVNTCESHASLTRRWLSPHRGVSKDKLTPYLRSFQLRCEL YRKRGDEALKHAFDAAL. | ATP-dependent protease Lon; Belongs to the peptidase S16 family. | 0.999 |
Nmlp_2533 | ths1 | Nmlp_2533 | Nmlp_3511 | DnaK domain protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2532; product: ISH4-type transposase NmIRS7 (nonfunctional); conceptual translation after in silico reconstruction: MFPIRRFVSESAAADLLQQVRWRDGVECPRCRSDLTVRNGSYR VYQRYLCENCGRTFNEKTGTIFAHAKLSLKEWYFTIYVFLRFNTSIRQIEAELNLSYR TVRRRVERFARALDSPSIRLSGPVEIDEVYVSAGLKGRERDSSRSRGLSTRGRGSYDG DKPPVFTLVDRGSDDRYVVPAKSAEESTIRLLLANCEQESITVYTDGFQAYEPLEDDA FTREYVVHGDGEYADGDIHVNTCESHASLTRRWLSPHRGVSKDKLTPYLRSFQLRCEL YRKRGDEALKHAFDAAL. | Thermosome subunit 1; Belongs to the TCP-1 chaperonin family. | 0.999 |
Nmlp_2533 | ths2 | Nmlp_2533 | Nmlp_1298 | DnaK domain protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2532; product: ISH4-type transposase NmIRS7 (nonfunctional); conceptual translation after in silico reconstruction: MFPIRRFVSESAAADLLQQVRWRDGVECPRCRSDLTVRNGSYR VYQRYLCENCGRTFNEKTGTIFAHAKLSLKEWYFTIYVFLRFNTSIRQIEAELNLSYR TVRRRVERFARALDSPSIRLSGPVEIDEVYVSAGLKGRERDSSRSRGLSTRGRGSYDG DKPPVFTLVDRGSDDRYVVPAKSAEESTIRLLLANCEQESITVYTDGFQAYEPLEDDA FTREYVVHGDGEYADGDIHVNTCESHASLTRRWLSPHRGVSKDKLTPYLRSFQLRCEL YRKRGDEALKHAFDAAL. | Thermosome subunit 2; Belongs to the TCP-1 chaperonin family. | 0.999 |
Nmlp_2533 | ths3 | Nmlp_2533 | Nmlp_3245 | DnaK domain protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2532; product: ISH4-type transposase NmIRS7 (nonfunctional); conceptual translation after in silico reconstruction: MFPIRRFVSESAAADLLQQVRWRDGVECPRCRSDLTVRNGSYR VYQRYLCENCGRTFNEKTGTIFAHAKLSLKEWYFTIYVFLRFNTSIRQIEAELNLSYR TVRRRVERFARALDSPSIRLSGPVEIDEVYVSAGLKGRERDSSRSRGLSTRGRGSYDG DKPPVFTLVDRGSDDRYVVPAKSAEESTIRLLLANCEQESITVYTDGFQAYEPLEDDA FTREYVVHGDGEYADGDIHVNTCESHASLTRRWLSPHRGVSKDKLTPYLRSFQLRCEL YRKRGDEALKHAFDAAL. | Thermosome subunit 3; Belongs to the TCP-1 chaperonin family. | 0.999 |
Nmlp_3851 | Nmlp_3854 | Nmlp_3851 | Nmlp_3854 | Abi/CAAX domain protein. | S-adenosylmethionine hydroxide adenosyltransferase family protein. | 0.666 |
Nmlp_3851 | lon | Nmlp_3851 | Nmlp_3852 | Abi/CAAX domain protein. | ATP-dependent protease Lon; Belongs to the peptidase S16 family. | 0.857 |
Nmlp_3851 | nadM | Nmlp_3851 | Nmlp_3853 | Abi/CAAX domain protein. | Nicotinamide-nucleotide adenylyltransferase. | 0.694 |
Nmlp_3854 | Nmlp_3851 | Nmlp_3854 | Nmlp_3851 | S-adenosylmethionine hydroxide adenosyltransferase family protein. | Abi/CAAX domain protein. | 0.666 |
Nmlp_3854 | lon | Nmlp_3854 | Nmlp_3852 | S-adenosylmethionine hydroxide adenosyltransferase family protein. | ATP-dependent protease Lon; Belongs to the peptidase S16 family. | 0.694 |
Nmlp_3854 | nadM | Nmlp_3854 | Nmlp_3853 | S-adenosylmethionine hydroxide adenosyltransferase family protein. | Nicotinamide-nucleotide adenylyltransferase. | 0.860 |
dnaJ | Nmlp_2533 | Nmlp_3591 | Nmlp_2533 | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, [...] | DnaK domain protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2532; product: ISH4-type transposase NmIRS7 (nonfunctional); conceptual translation after in silico reconstruction: MFPIRRFVSESAAADLLQQVRWRDGVECPRCRSDLTVRNGSYR VYQRYLCENCGRTFNEKTGTIFAHAKLSLKEWYFTIYVFLRFNTSIRQIEAELNLSYR TVRRRVERFARALDSPSIRLSGPVEIDEVYVSAGLKGRERDSSRSRGLSTRGRGSYDG DKPPVFTLVDRGSDDRYVVPAKSAEESTIRLLLANCEQESITVYTDGFQAYEPLEDDA FTREYVVHGDGEYADGDIHVNTCESHASLTRRWLSPHRGVSKDKLTPYLRSFQLRCEL YRKRGDEALKHAFDAAL. | 0.999 |
dnaJ | dnaK | Nmlp_3591 | Nmlp_3588 | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, [...] | Hsp70-type molecular chaperone DnaK; Acts as a chaperone. | 0.999 |
dnaJ | grpE | Nmlp_3591 | Nmlp_3586 | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, [...] | DnaJ/DnaK ATPase stimulator GrpE; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several round [...] | 0.986 |
dnaJ | lon | Nmlp_3591 | Nmlp_3852 | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, [...] | ATP-dependent protease Lon; Belongs to the peptidase S16 family. | 0.831 |
dnaJ | ths1 | Nmlp_3591 | Nmlp_3511 | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, [...] | Thermosome subunit 1; Belongs to the TCP-1 chaperonin family. | 0.796 |
dnaJ | ths2 | Nmlp_3591 | Nmlp_1298 | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, [...] | Thermosome subunit 2; Belongs to the TCP-1 chaperonin family. | 0.796 |
dnaJ | ths3 | Nmlp_3591 | Nmlp_3245 | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, [...] | Thermosome subunit 3; Belongs to the TCP-1 chaperonin family. | 0.796 |