Export your current network:
... as a bitmap image:
file format is 'PNG': portable network graphic
... as a high-resolution bitmap:
same PNG format, but at higher resolution
... as a vector graphic:
SVG: scalable vector graphic - can be opened and edited in Illustrator, CorelDraw, Dia, etc
... as short tabular text output:
TSV: tab separated values - can be opened in Excel and Cytoscape (lists only one-way edges: A-B)
... as tabular text output:
TSV: tab separated values - can be opened in Excel (lists reciprocal edges: A-B,B-A)
... as an XML summary:
structured XML interaction data, according to the 'PSI-MI' data standard
... protein node degrees:
node degree of proteins in your network (given the current score cut-off)
... network coordinates:
a flat-file format describing the coordinates and colors of nodes in the network
... protein sequences:
MFA: multi-fasta format - containing the aminoacid sequences in the network
... protein annotations:
a tab-delimited file describing the names, domains and descriptions of proteins in your network
... functional annotations:
a tab-delimited file containing all known functional terms of protiens in your network
Browse interactions in tabular form:
node1 | node2 | node1 accession | node2 accession | node1 annotation | node2 annotation | score |
NP_1424A | NP_2022A | NP_1424A | NP_2022A | DUF83 domain protein. | DUF447 family protein. | 0.710 |
NP_1424A | NP_4020A | NP_1424A | NP_4020A | DUF83 domain protein. | Type IV pilus biogenesis complex membrane subunit. | 0.731 |
NP_1424A | pibD | NP_1424A | NP_1276A | DUF83 domain protein. | Prepilin/preflagellin peptidase. | 0.497 |
NP_1424A | pilA1 | NP_1424A | NP_1956A | DUF83 domain protein. | Pilin PilA; Locus_tag: NP_1954A; gene has in-frame stop codons and is truncated at the C-terminus; conceptual translation after in silico reconstruction: MLSNSVDTDTAKRSLVETYDPPNYDDPWDAVEDYERVQRYTAKHPQQGSQAVSTAVDL PRGRIRSWVDGDGMPDCYRCLQTALENGWILNGWEDDTARSMTTLAATLASGSINEHW TPTWVTDGDDEADALRHHADRANVVIEQAREAEDDRPAEWRPAESASVLGRELYTLGH RGDK; product: uncharacterized protein (nonfunctional). | 0.608 |
NP_2022A | NP_1424A | NP_2022A | NP_1424A | DUF447 family protein. | DUF83 domain protein. | 0.710 |
NP_2022A | NP_4020A | NP_2022A | NP_4020A | DUF447 family protein. | Type IV pilus biogenesis complex membrane subunit. | 0.720 |
NP_2022A | pibD | NP_2022A | NP_1276A | DUF447 family protein. | Prepilin/preflagellin peptidase. | 0.644 |
NP_2022A | pilA1 | NP_2022A | NP_1956A | DUF447 family protein. | Pilin PilA; Locus_tag: NP_1954A; gene has in-frame stop codons and is truncated at the C-terminus; conceptual translation after in silico reconstruction: MLSNSVDTDTAKRSLVETYDPPNYDDPWDAVEDYERVQRYTAKHPQQGSQAVSTAVDL PRGRIRSWVDGDGMPDCYRCLQTALENGWILNGWEDDTARSMTTLAATLASGSINEHW TPTWVTDGDDEADALRHHADRANVVIEQAREAEDDRPAEWRPAESASVLGRELYTLGH RGDK; product: uncharacterized protein (nonfunctional). | 0.533 |
NP_4010A | NP_4012A | NP_4010A | NP_4012A | Probable secreted glycoprotein. | Probable secreted glycoprotein. | 0.857 |
NP_4010A | NP_4014A | NP_4010A | NP_4014A | Probable secreted glycoprotein. | Uncharacterized protein. | 0.857 |
NP_4010A | NP_4016A | NP_4010A | NP_4016A | Probable secreted glycoprotein. | Uncharacterized protein. | 0.857 |
NP_4010A | NP_4018A | NP_4010A | NP_4018A | Probable secreted glycoprotein. | Uncharacterized protein. | 0.857 |
NP_4010A | NP_4020A | NP_4010A | NP_4020A | Probable secreted glycoprotein. | Type IV pilus biogenesis complex membrane subunit. | 0.857 |
NP_4010A | NP_4022A | NP_4010A | NP_4022A | Probable secreted glycoprotein. | Type IV pilus biogenesis complex ATPase subunit. | 0.804 |
NP_4012A | NP_4010A | NP_4012A | NP_4010A | Probable secreted glycoprotein. | Probable secreted glycoprotein. | 0.857 |
NP_4012A | NP_4014A | NP_4012A | NP_4014A | Probable secreted glycoprotein. | Uncharacterized protein. | 0.857 |
NP_4012A | NP_4016A | NP_4012A | NP_4016A | Probable secreted glycoprotein. | Uncharacterized protein. | 0.857 |
NP_4012A | NP_4018A | NP_4012A | NP_4018A | Probable secreted glycoprotein. | Uncharacterized protein. | 0.857 |
NP_4012A | NP_4020A | NP_4012A | NP_4020A | Probable secreted glycoprotein. | Type IV pilus biogenesis complex membrane subunit. | 0.857 |
NP_4012A | NP_4022A | NP_4012A | NP_4022A | Probable secreted glycoprotein. | Type IV pilus biogenesis complex ATPase subunit. | 0.804 |
page 1 of 4