Export your current network:
... as a bitmap image:
file format is 'PNG': portable network graphic
... as a high-resolution bitmap:
same PNG format, but at higher resolution
... as a vector graphic:
SVG: scalable vector graphic - can be opened and edited in Illustrator, CorelDraw, Dia, etc
... as short tabular text output:
TSV: tab separated values - can be opened in Excel and Cytoscape (lists only one-way edges: A-B)
... as tabular text output:
TSV: tab separated values - can be opened in Excel (lists reciprocal edges: A-B,B-A)
... as an XML summary:
structured XML interaction data, according to the 'PSI-MI' data standard
... protein node degrees:
node degree of proteins in your network (given the current score cut-off)
... network coordinates:
a flat-file format describing the coordinates and colors of nodes in the network
... protein sequences:
MFA: multi-fasta format - containing the aminoacid sequences in the network
... protein annotations:
a tab-delimited file describing the names, domains and descriptions of proteins in your network
... functional annotations:
a tab-delimited file containing all known functional terms of protiens in your network
Browse interactions in tabular form:
node1 | node2 | node1 accession | node2 accession | node1 annotation | node2 annotation | score |
A0A088AF79 | PROH3_APIME | A0A088AF79 | P85828 | Uncharacterized protein. | Brain peptide ITGQGNRIF. | 0.408 |
Atk | PROH3_APIME | Q868G6 | P85828 | Brain peptide VLSMDGYQNILDKKDELLGEWE; Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Associated with sex-specific or age/division of labor-selective behavior and/or physiology of honeybees; Belongs to the tachykinin family. | Brain peptide ITGQGNRIF. | 0.408 |
NPF | ORCK1_APIME | A0A088AGT1 | P85832 | Uncharacterized protein. | Brain peptide LTNYLATTGHGTNTGGPVLT; Myotropic peptides. | 0.410 |
NPF | PROH1_APIME | A0A088AGT1 | P85798 | Uncharacterized protein. | Brain peptide SYWKQCAFNAVSCF-amide. | 0.403 |
NPF | PROH3_APIME | A0A088AGT1 | P85828 | Uncharacterized protein. | Brain peptide ITGQGNRIF. | 0.400 |
ORCK1_APIME | NPF | P85832 | A0A088AGT1 | Brain peptide LTNYLATTGHGTNTGGPVLT; Myotropic peptides. | Uncharacterized protein. | 0.410 |
ORCK1_APIME | PROH1_APIME | P85832 | P85798 | Brain peptide LTNYLATTGHGTNTGGPVLT; Myotropic peptides. | Brain peptide SYWKQCAFNAVSCF-amide. | 0.507 |
ORCK1_APIME | PROH3_APIME | P85832 | P85828 | Brain peptide LTNYLATTGHGTNTGGPVLT; Myotropic peptides. | Brain peptide ITGQGNRIF. | 0.506 |
ORCK1_APIME | PROH4_APIME | P85832 | P85831 | Brain peptide LTNYLATTGHGTNTGGPVLT; Myotropic peptides. | Brain peptide IDLSRFYGHFNT. | 0.408 |
PROH1_APIME | NPF | P85798 | A0A088AGT1 | Brain peptide SYWKQCAFNAVSCF-amide. | Uncharacterized protein. | 0.403 |
PROH1_APIME | ORCK1_APIME | P85798 | P85832 | Brain peptide SYWKQCAFNAVSCF-amide. | Brain peptide LTNYLATTGHGTNTGGPVLT; Myotropic peptides. | 0.507 |
PROH1_APIME | PROH3_APIME | P85798 | P85828 | Brain peptide SYWKQCAFNAVSCF-amide. | Brain peptide ITGQGNRIF. | 0.422 |
PROH1_APIME | PROH4_APIME | P85798 | P85831 | Brain peptide SYWKQCAFNAVSCF-amide. | Brain peptide IDLSRFYGHFNT. | 0.504 |
PROH2_APIME | PROH3_APIME | P85799 | P85828 | Brain peptide SQAYDPYSNAAQFQLSSQSRGYPYQHRLVY. | Brain peptide ITGQGNRIF. | 0.403 |
PROH3_APIME | A0A088AF79 | P85828 | A0A088AF79 | Brain peptide ITGQGNRIF. | Uncharacterized protein. | 0.408 |
PROH3_APIME | Atk | P85828 | Q868G6 | Brain peptide ITGQGNRIF. | Brain peptide VLSMDGYQNILDKKDELLGEWE; Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Associated with sex-specific or age/division of labor-selective behavior and/or physiology of honeybees; Belongs to the tachykinin family. | 0.408 |
PROH3_APIME | NPF | P85828 | A0A088AGT1 | Brain peptide ITGQGNRIF. | Uncharacterized protein. | 0.400 |
PROH3_APIME | ORCK1_APIME | P85828 | P85832 | Brain peptide ITGQGNRIF. | Brain peptide LTNYLATTGHGTNTGGPVLT; Myotropic peptides. | 0.506 |
PROH3_APIME | PROH1_APIME | P85828 | P85798 | Brain peptide ITGQGNRIF. | Brain peptide SYWKQCAFNAVSCF-amide. | 0.422 |
PROH3_APIME | PROH2_APIME | P85828 | P85799 | Brain peptide ITGQGNRIF. | Brain peptide SQAYDPYSNAAQFQLSSQSRGYPYQHRLVY. | 0.403 |
page 1 of 2